Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 5 of 1,510,353 results for " "

  1. Epitope mapping of region 11-70 of ovalbumin (Gal d I) using five synthetic peptides.

    ID: 1474360

    Description: epitope description:IMSALAMVYLGAK antigen name:Gal d 2 host organism:Homo sapiens

    Publication: 7950407;

  2. Epitope mapping of region 11-70 of ovalbumin (Gal d I) using five synthetic peptides.

    ID: 1474364

    Description: epitope description:VVRFDKLPGFGDSIE antigen name:Gal d 2 host organism:Homo sapiens

    Publication: 7950407;

  3. Epitope mapping of region 11-70 of ovalbumin (Gal d I) using five synthetic peptides.

    ID: 1474365

    Description: epitope description:VVRFDKLPGFGDSIE antigen name:Gal d 2 host organism:Oryctolagus cuniculus

    Publication: 7950407;

  4. Epitope mapping of region 11-70 of ovalbumin (Gal d I) using five synthetic peptides.

    ID: 1474366

    Description: epitope description:VVRFDKLPGFGDSIE antigen name:Gal d 2 host organism:Oryctolagus cuniculus

    Publication: 7950407;

  5. Effective synthetic peptide vaccine for foot-and-mouth disease in swine.

    ID: 1474391

    Description: epitope description:VYNGNCKYGENAVTNVRGDLQVLAQKAARCLPTSFNYGAIK host organism:Cavia porcellus Duncan-Hartley antibody name:Guinea pig sera

    Publication: 12057619;
Displaying 5 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston