IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

ID: 1602857

Description: epitope description:WDLNAASAYC antigen name:Hev b 6 host organism:Homo sapiens

IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

ID: 1602860

Description: epitope description:NAASAYCSTW antigen name:Hev b 6 host organism:Homo sapiens

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594726

Description: epitope description:VLNLTAWN antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594728

Description: epitope description:AVLNLTAW antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594732

Description: epitope description:TAVLNLTA antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594734

Description: epitope description:PTAVLNLT antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594735

Description: epitope description:PTAVLNLT antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594736

Description: epitope description:PTAVLNLT antigen name:Major outer membrane porin host organism:Mus musculus C57BL/6

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594738

Description: epitope description:LPTAVLNL antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594756

Description: epitope description:AGVATATG antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594758

Description: epitope description:DAGVATAT antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594761

Description: epitope description:TDAGVATA antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594762

Description: epitope description:TDAGVATA antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594770

Description: epitope description:PLPTDAGV antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594771

Description: epitope description:PLPTDAGV antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594773

Description: epitope description:FPLPTDAG antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594774

Description: epitope description:FPLPTDAG antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594778

Description: epitope description:AFPLPTDA antigen name:Major outer membrane porin host organism:Mus musculus C57BL/6

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594779

Description: epitope description:VAFPLPTD antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594784

Description: epitope description:GVAFPLPT antigen name:Major outer membrane porin host organism:Mus musculus C57BL/6

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594788

Description: epitope description:YKGVAFPL antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594789

Description: epitope description:YKGVAFPL antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594790

Description: epitope description:YKGVAFPL antigen name:Major outer membrane porin host organism:Mus musculus C57BL/6

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594793

Description: epitope description:GYKGVAFP antigen name:Major outer membrane porin host organism:Mus musculus C57BL/6

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594800

Description: epitope description:VSLSNGVV antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594802

Description: epitope description:VSLSNGVV antigen name:Major outer membrane porin host organism:Mus musculus C57BL/6

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594803

Description: epitope description:NVSLSNGV antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594805

Description: epitope description:NVSLSNGV antigen name:Major outer membrane porin host organism:Mus musculus C57BL/6

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594807

Description: epitope description:PNVSLSNG antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594808

Description: epitope description:PNVSLSNG antigen name:Major outer membrane porin host organism:Mus musculus C57BL/6

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594813

Description: epitope description:ELPNVSLS antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594814

Description: epitope description:ELPNVSLS antigen name:Major outer membrane porin host organism:Mus musculus C57BL/6

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594838

Description: epitope description:KGTTVNAN antigen name:Major outer membrane porin host organism:Mus musculus C57BL/6

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594841

Description: epitope description:VKGTTVNA antigen name:Major outer membrane porin host organism:Mus musculus C57BL/6

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594844

Description: epitope description:GVKGTTVN antigen name:Major outer membrane porin host organism:Mus musculus C57BL/6

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594849

Description: epitope description:LFGVKGTT antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594855

Description: epitope description:AVDRPNPA antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594857

Description: epitope description:TAVDRPNP antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594865

Description: epitope description:YTTAVDRP antigen name:Major outer membrane porin host organism:Mus musculus C57BL/6

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594876

Description: epitope description:AAANYTTA antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594878

Description: epitope description:SAAANYTT antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594879

Description: epitope description:SAAANYTT antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594880

Description: epitope description:SAAANYTT antigen name:Major outer membrane porin host organism:Mus musculus C57BL/6

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594885

Description: epitope description:TGSAAANY antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594890

Description: epitope description:KPTGSAAA antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594891

Description: epitope description:KPTGSAAA antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594892

Description: epitope description:KPTGSAAA antigen name:Major outer membrane porin host organism:Mus musculus C57BL/6

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594894

Description: epitope description:AKPTGSAA antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594895

Description: epitope description:AKPTGSAA antigen name:Major outer membrane porin host organism:Mus musculus C57BL/6

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594900

Description: epitope description:MGAKPTGS antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594902

Description: epitope description:SMGAKPTG antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594912

Description: epitope description:KTFSMGAK antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1594922

Description: epitope description:DAPKTFSM antigen name:Major outer membrane porin host organism:Mus musculus C57BL/6

The ring-infected erythrocyte surface antigen (RESA) polypeptide of Plasmodium falciparum contains two separate blocks of tandem repeats encoding anti...

ID: 1594945

Description: epitope description:DDEHVEEPTVA antigen name:DNAJ protein, putative host organism:Homo sapiens antibody name:Human sera

Sequence of myosin-crossreactive epitopes of streptococcal M protein.

ID: 1594955

Description: epitope description:KTKNEGLKTENEGLKTENEGLKTENEG antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

Sequence of myosin-crossreactive epitopes of streptococcal M protein.

ID: 1594959

Description: epitope description:TIGTLKKILDETVDKLAKEQKSKQNIGALKQEL antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

Antibodies raised in a natural host and monoclonal antibodies recognize similar antigenic features of foot-and-mouth disease virus.

ID: 1594965

Description: epitope description:YTASARGDLAHLTTTHARHLP antigen name:Polyprotein host organism:Sus scrofa Landrace X Large White

Mapping of antigenic sites involved in serotype-cross-reactive neutralization on group A rotavirus outercapsid glycoprotein VP7.

ID: 1594970

Description: epitope description:S94 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus antibody name:N-mAb 57/8

Synthetic peptides corresponding to protective epitopes of Escherichia coli digalactoside-binding pilin prevent infection in a murine pyelonephritis m...

ID: 1595129

Description: epitope description:PQGQGKVT antigen name:Pap fimbrial major pilin protein host organism:Mus musculus BALB/c

Synthetic peptides corresponding to protective epitopes of Escherichia coli digalactoside-binding pilin prevent infection in a murine pyelonephritis m...

ID: 1595130

Description: epitope description:PQGQGKVT antigen name:Pap fimbrial major pilin protein host organism:Mus musculus BALB/c

Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

ID: 1595148

Description: epitope description:QPKLPTAVLNLTAWNPSLLGNATALSTTDSFSDFM antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

Anti-alpha-gliadin antibodies (AGA) in the serum of coeliac children and controls recognize an identical collection of linear epitopes of alpha-gliadi...

ID: 1595241

Description: epitope description:LALLAIVATTATTAVRVPVPQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

Anti-alpha-gliadin antibodies (AGA) in the serum of coeliac children and controls recognize an identical collection of linear epitopes of alpha-gliadi...

ID: 1595250

Description: epitope description:TAVRVPVPQLQPQNPSQQQPQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

Anti-alpha-gliadin antibodies (AGA) in the serum of coeliac children and controls recognize an identical collection of linear epitopes of alpha-gliadi...

ID: 1595255

Description: epitope description:VPQLQPQNPSQQQPQEQVPLV antigen name:Tri a 21 host organism:Homo sapiens

Anti-alpha-gliadin antibodies (AGA) in the serum of coeliac children and controls recognize an identical collection of linear epitopes of alpha-gliadi...

ID: 1595260

Description: epitope description:QPQEQVPLVQQQQFLGQQQPF antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

Anti-alpha-gliadin antibodies (AGA) in the serum of coeliac children and controls recognize an identical collection of linear epitopes of alpha-gliadi...

ID: 1595262

Description: epitope description:QPQEQVPLVQQQQFLGQQQPF antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

Anti-alpha-gliadin antibodies (AGA) in the serum of coeliac children and controls recognize an identical collection of linear epitopes of alpha-gliadi...

ID: 1595265

Description: epitope description:PLVQQQQFLGQQQPFPPQQPY antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

Anti-alpha-gliadin antibodies (AGA) in the serum of coeliac children and controls recognize an identical collection of linear epitopes of alpha-gliadi...

ID: 1595267

Description: epitope description:PLVQQQQFLGQQQPFPPQQPY antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

Anti-alpha-gliadin antibodies (AGA) in the serum of coeliac children and controls recognize an identical collection of linear epitopes of alpha-gliadi...

ID: 1595272

Description: epitope description:QPFPPQQPYPQPQPFPSQQPY antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

Anti-alpha-gliadin antibodies (AGA) in the serum of coeliac children and controls recognize an identical collection of linear epitopes of alpha-gliadi...

ID: 1595278

Description: epitope description:QPYPQPQPFPSQQPYLQLQPF antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

Anti-alpha-gliadin antibodies (AGA) in the serum of coeliac children and controls recognize an identical collection of linear epitopes of alpha-gliadi...

ID: 1595280

Description: epitope description:QPFPSQQPYLQLQPFPQPQLP antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

Anti-alpha-gliadin antibodies (AGA) in the serum of coeliac children and controls recognize an identical collection of linear epitopes of alpha-gliadi...

ID: 1595283

Description: epitope description:QPFPSQQPYLQLQPFPQPQLP antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

Anti-alpha-gliadin antibodies (AGA) in the serum of coeliac children and controls recognize an identical collection of linear epitopes of alpha-gliadi...

ID: 1595285

Description: epitope description:QPYLQLQPFPQPQLPYSQPQP antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

Anti-alpha-gliadin antibodies (AGA) in the serum of coeliac children and controls recognize an identical collection of linear epitopes of alpha-gliadi...

ID: 1595286

Description: epitope description:QPYLQLQPFPQPQLPYSQPQP antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

Anti-alpha-gliadin antibodies (AGA) in the serum of coeliac children and controls recognize an identical collection of linear epitopes of alpha-gliadi...

ID: 1595290

Description: epitope description:QPFPQPQLPYSQPQPFRPQQP antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

Anti-alpha-gliadin antibodies (AGA) in the serum of coeliac children and controls recognize an identical collection of linear epitopes of alpha-gliadi...

ID: 1595292

Description: epitope description:QPFPPQLPYSQPQPFRPQQPY antigen name:Tri a 21 host organism:Homo sapiens

Anti-alpha-gliadin antibodies (AGA) in the serum of coeliac children and controls recognize an identical collection of linear epitopes of alpha-gliadi...

ID: 1595293

Description: epitope description:QPFPPQLPYSQPQPFRPQQPY antigen name:Tri a 21 host organism:Homo sapiens

Anti-alpha-gliadin antibodies (AGA) in the serum of coeliac children and controls recognize an identical collection of linear epitopes of alpha-gliadi...

ID: 1595302

Description: epitope description:QPFRPQQPYPQPQPQYSQPQQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

Anti-alpha-gliadin antibodies (AGA) in the serum of coeliac children and controls recognize an identical collection of linear epitopes of alpha-gliadi...

ID: 1595312

Description: epitope description:PQQPISQQQQQQQQQQQQQQQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

Anti-alpha-gliadin antibodies (AGA) in the serum of coeliac children and controls recognize an identical collection of linear epitopes of alpha-gliadi...

ID: 1595329

Description: epitope description:QILQQILQQQLIFCMDVVLQQ antigen name:Tri a 21 host organism:Homo sapiens

Anti-alpha-gliadin antibodies (AGA) in the serum of coeliac children and controls recognize an identical collection of linear epitopes of alpha-gliadi...

ID: 1595333

Description: epitope description:LQQQLIFCMDVVLQQHNIAHG antigen name:Tri a 21 host organism:Homo sapiens

Anti-alpha-gliadin antibodies (AGA) in the serum of coeliac children and controls recognize an identical collection of linear epitopes of alpha-gliadi...

ID: 1595339

Description: epitope description:FCMDVVLQQHNIAHGRSQVLQ antigen name:Tri a 21 host organism:Homo sapiens

Anti-alpha-gliadin antibodies (AGA) in the serum of coeliac children and controls recognize an identical collection of linear epitopes of alpha-gliadi...

ID: 1595340

Description: epitope description:LQQHNIAHGRSQVLQQSTYQL antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

Anti-alpha-gliadin antibodies (AGA) in the serum of coeliac children and controls recognize an identical collection of linear epitopes of alpha-gliadi...

ID: 1595345

Description: epitope description:AHGRSQVLQQSTYQLLQELCC antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

Anti-alpha-gliadin antibodies (AGA) in the serum of coeliac children and controls recognize an identical collection of linear epitopes of alpha-gliadi...

ID: 1595347

Description: epitope description:AHGRSQVLQQSTYQLLQELCC antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

Anti-alpha-gliadin antibodies (AGA) in the serum of coeliac children and controls recognize an identical collection of linear epitopes of alpha-gliadi...

ID: 1595348

Description: epitope description:VLQQSTYQLLQELCCQHLWQI antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

Anti-alpha-gliadin antibodies (AGA) in the serum of coeliac children and controls recognize an identical collection of linear epitopes of alpha-gliadi...

ID: 1595349

Description: epitope description:VLQQSTYQLLQELCCQHLWQI antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

Anti-alpha-gliadin antibodies (AGA) in the serum of coeliac children and controls recognize an identical collection of linear epitopes of alpha-gliadi...

ID: 1595352

Description: epitope description:YQLLQELCCQHLWQIPEQSQC antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

Anti-alpha-gliadin antibodies (AGA) in the serum of coeliac children and controls recognize an identical collection of linear epitopes of alpha-gliadi...

ID: 1595355

Description: epitope description:YQLLQELCCQHLWQIPEQSQC antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

Anti-alpha-gliadin antibodies (AGA) in the serum of coeliac children and controls recognize an identical collection of linear epitopes of alpha-gliadi...

ID: 1595361

Description: epitope description:WQIPEQSQCQAIHNVVHAIIL antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

The recognition pattern of sequential B cell epitopes of beta-lactoglobulin does not vary with the clinical manifestations of cow's milk allergy.

ID: 1600847

Description: epitope description:EKFDKALKAL antigen name:Bos d 5 host organism:Homo sapiens

The recognition pattern of sequential B cell epitopes of beta-lactoglobulin does not vary with the clinical manifestations of cow's milk allergy.

ID: 1600851

Description: epitope description:KALKALPMHI antigen name:Bos d 5 host organism:Homo sapiens

The recognition pattern of sequential B cell epitopes of beta-lactoglobulin does not vary with the clinical manifestations of cow's milk allergy.

ID: 1600862

Description: epitope description:LSFNPTQLEE antigen name:Bos d 5 host organism:Homo sapiens

The recognition pattern of sequential B cell epitopes of beta-lactoglobulin does not vary with the clinical manifestations of cow's milk allergy.

ID: 1600863

Description: epitope description:SFNPTQLEEQ antigen name:Bos d 5 host organism:Homo sapiens

Isotypic and IgG subclass restriction of the humoral immune responses to human T-lymphotropic virus type-I.

ID: 1600871

Description: epitope description:PPSSPTHDPPDSDPQI antigen name:Gag polyprotein host organism:Homo sapiens

Isotypic and IgG subclass restriction of the humoral immune responses to human T-lymphotropic virus type-I.

ID: 1600877

Description: epitope description:SPNVSVPSSSSTPLLY antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

Neutralizing antibodies to human rhinovirus produced in laboratory animals and humans that recognize a linear sequence from VP2.

ID: 1600898

Description: epitope description:TRLNPD antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:8F5

Serological responses to the B subunit of Shiga-like toxin 1 and its peptide fragments indicate that the B subunit is a vaccine candidate to counter a...

ID: 1600903

Description: epitope description:KTNACHNGGGFSEVIFR antigen name:Shiga toxin 1 B subunit host organism:Oryctolagus cuniculus New Zealand White

Serological responses to the B subunit of Shiga-like toxin 1 and its peptide fragments indicate that the B subunit is a vaccine candidate to counter a...

ID: 1600909

Description: epitope description:FTVKVGDKELF antigen name:Shiga toxin 1 B subunit host organism:Oryctolagus cuniculus New Zealand White

Human IgE-binding epitopes of the latex allergen Hev b 5.

ID: 1600910

Description: epitope description:MASVEVES antigen name:Hev b 5 host organism:Homo sapiens