Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "
  1. Topography and immunogenicity of bluetongue virus VP7 epitopes.

    ID: 1478400

    Description: epitope description:ARQPYGFFLETEEVYQPG antigen name:Core protein VP7 host organism:Oryctolagus cuniculus antibody name:OAB

    Publication: 8629938;
  2. Topography and immunogenicity of bluetongue virus VP7 epitopes.

    ID: 1478405

    Description: epitope description:GVTVSVGGVDMRAGRIIAWDGQAALQIHNPTQQN antigen name:Core protein VP7 host organism:Oryctolagus cuniculus antibody name:Rabbit anti-ser...

    Publication: 8629938;
  3. Topography and immunogenicity of bluetongue virus VP7 epitopes.

    ID: 1478406

    Description: epitope description:QYPALT antigen name:Core protein VP7 host organism:Mus musculus antibody name:20D11, 20F10

    Publication: 8629938;
  4. Characterisation of mouse monoclonal antibodies for pneumolysin: fine epitope mapping and V gene usage.

    ID: 1478418

    Description: epitope description:RPPRYLANQ host organism:Mus musculus BALB/c antibody name:PLY-4

    Publication: 12941482;
  5. Characterisation of mouse monoclonal antibodies for pneumolysin: fine epitope mapping and V gene usage.

    ID: 1478420

    Description: epitope description:RLPRYMQEV host organism:Mus musculus BALB/c antibody name:PLY-4

    Publication: 12941482;
  6. Characterisation of mouse monoclonal antibodies for pneumolysin: fine epitope mapping and V gene usage.

    ID: 1478427

    Description: epitope description:GGQTFTDRE host organism:Mus musculus BALB/c antibody name:PLY-7

    Publication: 12941482;
  7. Efficient neutralization of foot-and-mouth disease virus by monovalent antibody binding.

    ID: 1478436

    Description: epitope description:YTASARGDLAHL antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:SD6

    Publication: 9371652;
  8. Antigenicity of a synthetic peptide from glucosyltransferases of Streptococcus mutans in humans.

    ID: 1478452

    Description: epitope description:ANDVDNSNPVVQAEQLNWL antigen name:UniProt:I6TQ53 host organism:Homo sapiens

    Publication: 9038329;
  9. The conserved undecapeptide shared by thiol-activated cytolysins is involved in membrane binding.

    ID: 1478454

    Description: epitope description:ECTGLAWEWWRT antigen name:Pneumolysin host organism:Mus musculus BALB/c antibody name:PLY-5

    Publication: 10526185;
  10. The conserved undecapeptide shared by thiol-activated cytolysins is involved in membrane binding.

    ID: 1478458

    Description: epitope description:ECTGLAWEWWRT antigen name:Pneumolysin host organism:Mus musculus BALB/c antibody name:PLY-5

    Publication: 10526185;
  11. The conserved undecapeptide shared by thiol-activated cytolysins is involved in membrane binding.

    ID: 1478461

    Description: epitope description:ECTGLAWEWWRT antigen name:Pneumolysin host organism:Mus musculus BALB/c antibody name:PLY-5

    Publication: 10526185;
  12. A dominant B-cell epitope on the 22 kDa tegumental membrane-associated antigen of Schistosoma japonicum maps to an EF-hand calcium binding domain.

    ID: 1478466

    Description: epitope description:MATTEYRLSLMEQFIRAFIE antigen name:Schistosoma japonicum protein host organism:Mus musculus CBA

    Publication: 9292892;
  13. A dominant B-cell epitope on the 22 kDa tegumental membrane-associated antigen of Schistosoma japonicum maps to an EF-hand calcium binding domain.

    ID: 1478470

    Description: epitope description:MATTEYRLSLMEQFIRAFIE antigen name:Schistosoma japonicum protein host organism:Mus musculus BALB/c

    Publication: 9292892;
  14. A dominant B-cell epitope on the 22 kDa tegumental membrane-associated antigen of Schistosoma japonicum maps to an EF-hand calcium binding domain.

    ID: 1478472

    Description: epitope description:MEQFIRAFIEIDKDNNELID antigen name:Schistosoma japonicum protein host organism:Mus musculus CBA

    Publication: 9292892;
  15. A dominant B-cell epitope on the 22 kDa tegumental membrane-associated antigen of Schistosoma japonicum maps to an EF-hand calcium binding domain.

    ID: 1478474

    Description: epitope description:IDKDNNELIDKQELTKYCQQ antigen name:Schistosoma japonicum protein host organism:Mus musculus C57BL/6

    Publication: 9292892;
  16. A dominant B-cell epitope on the 22 kDa tegumental membrane-associated antigen of Schistosoma japonicum maps to an EF-hand calcium binding domain.

    ID: 1478475

    Description: epitope description:IDKDNNELIDKQELTKYCQQ antigen name:Schistosoma japonicum protein host organism:Mus musculus CBA

    Publication: 9292892;
  17. A dominant B-cell epitope on the 22 kDa tegumental membrane-associated antigen of Schistosoma japonicum maps to an EF-hand calcium binding domain.

    ID: 1478486

    Description: epitope description:GKVSLEEFCRGFGLKVWEVR antigen name:Schistosoma japonicum protein host organism:Mus musculus C57BL/6

    Publication: 9292892;
  18. A dominant B-cell epitope on the 22 kDa tegumental membrane-associated antigen of Schistosoma japonicum maps to an EF-hand calcium binding domain.

    ID: 1478489

    Description: epitope description:GFGLKVWEVRREKEELKRDK antigen name:Schistosoma japonicum protein host organism:Mus musculus C57BL/6

    Publication: 9292892;
  19. A dominant B-cell epitope on the 22 kDa tegumental membrane-associated antigen of Schistosoma japonicum maps to an EF-hand calcium binding domain.

    ID: 1478495

    Description: epitope description:EGKVSTLPLDIQIIAATMSK antigen name:Schistosoma japonicum protein host organism:Mus musculus C57BL/6

    Publication: 9292892;
  20. A dominant B-cell epitope on the 22 kDa tegumental membrane-associated antigen of Schistosoma japonicum maps to an EF-hand calcium binding domain.

    ID: 1478498

    Description: epitope description:IQIIAATMSKAKQYNICCKF antigen name:Schistosoma japonicum protein host organism:Mus musculus C57BL/6

    Publication: 9292892;

Displaying 20 of 1,510,353 results for " "