Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1599005

    Description: epitope description:LSTRGVQIASNENMEAMDSNTLELRSRYWAIRTRSGGNTNQQR antigen name:Nucleoprotein host organism:Homo sapiens antibody name:Human sera

    Publication: 19381279;

  2. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1599006

    Description: epitope description:TEIIRMMESARPEDVSFQGRGVFELSDEKATNPIVPSFD antigen name:Nucleoprotein host organism:Homo sapiens antibody name:Human sera

    Publication: 19381279;

  3. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1599013

    Description: epitope description:LEWNDNTVRVTETIQRFAWRNSDEDGRLPLPPNQKR antigen name:Non-structural protein 1 host organism:Homo sapiens antibody name:Human sera

    Publication: 19381279;

  4. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1599019

    Description: epitope description:EKANPVNDLCYPGDFNDYEELKH antigen name:Hemagglutinin host organism:Homo sapiens antibody name:Human sera

    Publication: 19381279;

  5. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1599022

    Description: epitope description:KCQTPMGAINSSMPFHNIHPLTIGECPKYVKSNRLVLATGLRN antigen name:Hemagglutinin host organism:Homo sapiens antibody name:Human sera

    Publication: 19381279;

  6. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1599028

    Description: epitope description:QIGNMISIWVSHSIHTGNQHQSEPISNTNFLTEKAVASVKLAGNSSLCPIN antigen name:Neuraminidase host organism:Homo sapiens antibody name:Human sera

    Publication: 19381279;

  7. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1599029

    Description: epitope description:DNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKH antigen name:Neuraminidase host organism:Homo sapiens antibody name:Human sera

    Publication: 19381279;

  8. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1599038

    Description: epitope description:LMDHYLRIMSPVGTHKQIVYWKQWLSLKNPTQG antigen name:Protein PB1-F2 host organism:Homo sapiens antibody name:Human sera

    Publication: 19381279;

  9. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1599041

    Description: epitope description:MASQGTKRSYEQMETGGERQNATE antigen name:Nucleoprotein host organism:Homo sapiens antibody name:Human sera

    Publication: 19381279;

  10. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1599044

    Description: epitope description:ETYVLSIIPSGPLKAEIAQKLEDVFAGKN antigen name:Matrix protein 1 host organism:Homo sapiens antibody name:Human sera

    Publication: 19381279;

  11. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1599045

    Description: epitope description:MSLLTEVETYVLSIIPSGPLKAEIAQKLEDVFAGKNTDLEALMEWLKTRPI antigen name:Matrix protein 1 host organism:Homo sapiens antibody name:Human s...

    Publication: 19381279;

  12. Identification of ABC transporters in vancomycin-resistant Enterococcus faecium as potential targets for antibody therapy.

    ID: 1599054

    Description: epitope description:MRRVAIAGVLAMRPE antigen name:UniProt:H8L8K3 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 12110480;

  13. Identification of ABC transporters in vancomycin-resistant Enterococcus faecium as potential targets for antibody therapy.

    ID: 1599063

    Description: epitope description:MRRVAIAGVLAMRPE antigen name:UniProt:H8L8K3 host organism:Homo sapiens

    Publication: 12110480;

  14. Identification of ABC transporters in vancomycin-resistant Enterococcus faecium as potential targets for antibody therapy.

    ID: 1599068

    Description: epitope description:LKPIRKKVGIVFQFP antigen name:UniProt:H8L8K3 host organism:Homo sapiens

    Publication: 12110480;

  15. Antibody recognition of a highly conserved influenza virus epitope.

    ID: 1599747

    Description: epitope description:A: H44, Q46, D47, I48, S304, M305, P306, T331; B: D365, G366, W367, K384, T387, Q388, I391, D392, T395, V398, N399, I402; antigen ...

    Publication: 19251591;

  16. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1599889

    Description: epitope description:TVLPWKVHSY antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  17. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1599891

    Description: epitope description:KVHSYEVDL antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  18. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1599896

    Description: epitope description:THNAILKPKK antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  19. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1599904

    Description: epitope description:TVKVYVVLND antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  20. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1599906

    Description: epitope description:VVLNDIAGKA antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  21. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1599912

    Description: epitope description:KALLANVNAA antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  22. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1599915

    Description: epitope description:NVNAADFDAK antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  23. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1599921

    Description: epitope description:ELSTQAQALG antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  24. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1599922

    Description: epitope description:AQALGTVADG antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  25. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1599924

    Description: epitope description:TVADGPNPAT antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  26. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1599925

    Description: epitope description:TVADGPNPAT antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  27. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1599928

    Description: epitope description:AAGKIAKKNG antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  28. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1599935

    Description: epitope description:TTDETIMMTC antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  29. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1599942

    Description: epitope description:AAVSEANAIA antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  30. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1599947

    Description: epitope description:GIKNQAKVTV antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  31. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1599949

    Description: epitope description:AKVTVERSVA antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  32. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1599961

    Description: epitope description:TTQIGEIAAG antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  33. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1599965

    Description: epitope description:SVLATITDIR antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  34. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1599967

    Description: epitope description:ITDIRWVVAQ antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  35. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1599968

    Description: epitope description:WVVAQGERRQ antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  36. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1599969

    Description: epitope description:WVVAQGERRQ antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  37. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1599973

    Description: epitope description:YLSKKRGTVP antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  38. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1599974

    Description: epitope description:RGTVPENTWV antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  39. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1599975

    Description: epitope description:RGTVPENTWV antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  40. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1599984

    Description: epitope description:STFHTNATEY antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  41. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1599986

    Description: epitope description:NATEYYDYAG antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  42. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1599992

    Description: epitope description:NTNEAVISGT antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  43. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1599995

    Description: epitope description:VISGTQVPTL antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  44. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1599996

    Description: epitope description:QVPTLADYQL antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  45. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1600000

    Description: epitope description:ADYQLQDVTG antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  46. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1600001

    Description: epitope description:ADYQLQDVTG antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  47. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1600003

    Description: epitope description:QDVTGELANA antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  48. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1600008

    Description: epitope description:LLPNTHKSGA antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  49. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1600014

    Description: epitope description:DYKRGNTAYV antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  50. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1600024

    Description: epitope description:EAFIDRGKTY antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  51. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1600027

    Description: epitope description:RGKTYSDNTA antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  52. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1600029

    Description: epitope description:SDNTAVPEYV antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  53. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1600032

    Description: epitope description:AGEDFFVGEN antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  54. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1600036

    Description: epitope description:GQFYVSMKSV antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  55. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1600042

    Description: epitope description:GPGLVESAED antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  56. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1600047

    Description: epitope description:MKAHKYVKGK antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  57. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1600054

    Description: epitope description:TTSPDSWWNS antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  58. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1600055

    Description: epitope description:TTSPDSWWNS antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  59. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1600056

    Description: epitope description:SWWNSPVVRN antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  60. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1600057

    Description: epitope description:SWWNSPVVRN antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  61. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1600068

    Description: epitope description:NWNPLVPDPD antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  62. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1600070

    Description: epitope description:VPDPDPSNPE antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  63. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1600082

    Description: epitope description:EQPLPDQDTF antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  64. Immunochemical characterisation and epitope mapping of a novel fimbrial protein (Pg-II fimbria) of Porphyromonas gingivalis.

    ID: 1600085

    Description: epitope description:DQDTFMSVEV antigen name:Mfa1fimbrilin host organism:Homo sapiens

    Publication: 7581276;

  65. Serological responses to the B subunit of Shiga-like toxin 1 and its peptide fragments indicate that the B subunit is a vaccine candidate to counter a...

    ID: 1600250

    Description: epitope description:TPDCVTGKVEYTKYNDDDTFTVKVG antigen name:Shiga toxin 1 B subunit host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1705242;

  66. Immunological properties of recombinant porin of Haemophilus influenzae type b expressed in Bacillus subtilis.

    ID: 1600331

    Description: epitope description:VYNNEG antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7687584;

  67. Immunological properties of recombinant porin of Haemophilus influenzae type b expressed in Bacillus subtilis.

    ID: 1600332

    Description: epitope description:YNNEGT antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7687584;

  68. Immunological properties of recombinant porin of Haemophilus influenzae type b expressed in Bacillus subtilis.

    ID: 1600336

    Description: epitope description:GTNVEL antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7687584;

  69. Immunological properties of recombinant porin of Haemophilus influenzae type b expressed in Bacillus subtilis.

    ID: 1600339

    Description: epitope description:VELGGR antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7687584;

  70. Immunological properties of recombinant porin of Haemophilus influenzae type b expressed in Bacillus subtilis.

    ID: 1600341

    Description: epitope description:LGGRLS antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7687584;

  71. Immunological properties of recombinant porin of Haemophilus influenzae type b expressed in Bacillus subtilis.

    ID: 1600342

    Description: epitope description:GGRLSI antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7687584;

  72. Immunological properties of recombinant porin of Haemophilus influenzae type b expressed in Bacillus subtilis.

    ID: 1600346

    Description: epitope description:SIIAEQ antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7687584;

  73. Immunological properties of recombinant porin of Haemophilus influenzae type b expressed in Bacillus subtilis.

    ID: 1600358

    Description: epitope description:NQKQQH antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7687584;

  74. Immunological properties of recombinant porin of Haemophilus influenzae type b expressed in Bacillus subtilis.

    ID: 1600359

    Description: epitope description:QKQQHG antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7687584;

  75. Immunological properties of recombinant porin of Haemophilus influenzae type b expressed in Bacillus subtilis.

    ID: 1600360

    Description: epitope description:KQQHGA antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7687584;

  76. Immunological properties of recombinant porin of Haemophilus influenzae type b expressed in Bacillus subtilis.

    ID: 1600362

    Description: epitope description:QHGALR antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7687584;

  77. Immunological properties of recombinant porin of Haemophilus influenzae type b expressed in Bacillus subtilis.

    ID: 1600365

    Description: epitope description:ALRNQG antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7687584;

  78. Immunological properties of recombinant porin of Haemophilus influenzae type b expressed in Bacillus subtilis.

    ID: 1600375

    Description: epitope description:IKATHN antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7687584;

  79. Immunological properties of recombinant porin of Haemophilus influenzae type b expressed in Bacillus subtilis.

    ID: 1600382

    Description: epitope description:GDGFYA antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7687584;

  80. Immunological properties of recombinant porin of Haemophilus influenzae type b expressed in Bacillus subtilis.

    ID: 1600396

    Description: epitope description:VTKASE antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7687584;

  81. Immunological properties of recombinant porin of Haemophilus influenzae type b expressed in Bacillus subtilis.

    ID: 1600402

    Description: epitope description:NGSDNF antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7687584;

  82. Immunological properties of recombinant porin of Haemophilus influenzae type b expressed in Bacillus subtilis.

    ID: 1600408

    Description: epitope description:GDITSK antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7687584;

  83. Immunological properties of recombinant porin of Haemophilus influenzae type b expressed in Bacillus subtilis.

    ID: 1600409

    Description: epitope description:DITSKY antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7687584;

  84. Immunological properties of recombinant porin of Haemophilus influenzae type b expressed in Bacillus subtilis.

    ID: 1600417

    Description: epitope description:VTLGNK antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7687584;

  85. Immunological properties of recombinant porin of Haemophilus influenzae type b expressed in Bacillus subtilis.

    ID: 1600421

    Description: epitope description:NKAFGE antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7687584;

  86. Immunological properties of recombinant porin of Haemophilus influenzae type b expressed in Bacillus subtilis.

    ID: 1600425

    Description: epitope description:GEVKLG antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7687584;

  87. Immunological properties of recombinant porin of Haemophilus influenzae type b expressed in Bacillus subtilis.

    ID: 1600429

    Description: epitope description:LGRAKT antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7687584;

  88. Immunological properties of recombinant porin of Haemophilus influenzae type b expressed in Bacillus subtilis.

    ID: 1600440

    Description: epitope description:TSAEDK antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7687584;

  89. Immunological properties of recombinant porin of Haemophilus influenzae type b expressed in Bacillus subtilis.

    ID: 1600441

    Description: epitope description:SAEDKE antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7687584;

  90. Immunological properties of recombinant porin of Haemophilus influenzae type b expressed in Bacillus subtilis.

    ID: 1600450

    Description: epitope description:LNNSDY antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7687584;

  91. Immunological properties of recombinant porin of Haemophilus influenzae type b expressed in Bacillus subtilis.

    ID: 1600467

    Description: epitope description:FKGIDG antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7687584;

  92. Immunological properties of recombinant porin of Haemophilus influenzae type b expressed in Bacillus subtilis.

    ID: 1600468

    Description: epitope description:KGIDGL antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7687584;

  93. Immunological properties of recombinant porin of Haemophilus influenzae type b expressed in Bacillus subtilis.

    ID: 1600475

    Description: epitope description:LGANYL antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7687584;

  94. Immunological properties of recombinant porin of Haemophilus influenzae type b expressed in Bacillus subtilis.

    ID: 1600476

    Description: epitope description:GANYLL antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7687584;

  95. Immunological properties of recombinant porin of Haemophilus influenzae type b expressed in Bacillus subtilis.

    ID: 1600480

    Description: epitope description:LLAQKR antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7687584;

  96. Immunological properties of recombinant porin of Haemophilus influenzae type b expressed in Bacillus subtilis.

    ID: 1600483

    Description: epitope description:QKREGA antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7687584;

  97. Immunological properties of recombinant porin of Haemophilus influenzae type b expressed in Bacillus subtilis.

    ID: 1600490

    Description: epitope description:GENKRP antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7687584;

  98. Immunological properties of recombinant porin of Haemophilus influenzae type b expressed in Bacillus subtilis.

    ID: 1600500

    Description: epitope description:GEVRIG antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7687584;

  99. Immunological properties of recombinant porin of Haemophilus influenzae type b expressed in Bacillus subtilis.

    ID: 1600505

    Description: epitope description:GEINNG antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7687584;

  100. Immunological properties of recombinant porin of Haemophilus influenzae type b expressed in Bacillus subtilis.

    ID: 1600510

    Description: epitope description:GIQVGA antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7687584;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston