Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380437

    Description: epitope description:AETQHG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  2. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380438

    Description: epitope description:ETQHGT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  3. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380441

    Description: epitope description:HGTIVI antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  4. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380445

    Description: epitope description:VIRVQY antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  5. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380449

    Description: epitope description:QYEGDG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  6. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380452

    Description: epitope description:GDGSPC antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  7. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380465

    Description: epitope description:DLEKRH antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  8. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380466

    Description: epitope description:LEKRHV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  9. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380467

    Description: epitope description:EKRHVL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  10. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380469

    Description: epitope description:RHVLGR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  11. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380471

    Description: epitope description:VLGRLI antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  12. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380478

    Description: epitope description:VNPIVT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  13. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380479

    Description: epitope description:NPIVTE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  14. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380488

    Description: epitope description:PVNIEA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  15. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380489

    Description: epitope description:VNIEAE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  16. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380494

    Description: epitope description:EPPFGD antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  17. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380504

    Description: epitope description:IGVEPG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  18. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380505

    Description: epitope description:GVEPGQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  19. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380508

    Description: epitope description:PGQLKL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  20. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380512

    Description: epitope description:KLNWFK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  21. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380516

    Description: epitope description:FKKGSS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  22. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380519

    Description: epitope description:GSSIGQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  23. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380529

    Description: epitope description:ETTMRG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  24. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380531

    Description: epitope description:TMRGAK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  25. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380533

    Description: epitope description:RGAKRM antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  26. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380534

    Description: epitope description:GAKRMA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  27. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380538

    Description: epitope description:MAILGD antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  28. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380540

    Description: epitope description:ILGDTA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  29. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380542

    Description: epitope description:GDTAWD antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  30. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380548

    Description: epitope description:FGSLGG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  31. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380552

    Description: epitope description:GGVFTS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  32. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380556

    Description: epitope description:TSIGKA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  33. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380557

    Description: epitope description:SIGKAL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  34. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380565

    Description: epitope description:VFGAIY antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  35. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380570

    Description: epitope description:YGAAFS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  36. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380571

    Description: epitope description:GAAFSG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  37. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380580

    Description: epitope description:TMKILI antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  38. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380583

    Description: epitope description:ILIGVI antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  39. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380585

    Description: epitope description:IGVIIT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  40. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380587

    Description: epitope description:VIITWI antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  41. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380590

    Description: epitope description:TWIGMN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  42. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380595

    Description: epitope description:NSRSTS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  43. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380598

    Description: epitope description:STSLSV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  44. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380610

    Description: epitope description:GVVTLY antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  45. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380613

    Description: epitope description:TLYLGA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  46. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380636

    Description: epitope description:IGISNRDFV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  47. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380640

    Description: epitope description:VSGGSWVDIVLE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  48. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380641

    Description: epitope description:VSGGSWVDIVLE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  49. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380657

    Description: epitope description:NLEYTIVITP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  50. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380664

    Description: epitope description:RTGLDFN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  51. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380665

    Description: epitope description:RTGLDFN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  52. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380666

    Description: epitope description:AWLVHRQWFLDLPLPW antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  53. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380668

    Description: epitope description:AWLVHRQWFLDLPLPW antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  54. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380670

    Description: epitope description:TQGSNWIQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  55. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380673

    Description: epitope description:TQGSNWIQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  56. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380674

    Description: epitope description:ETLVTFKN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  57. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380686

    Description: epitope description:GTIVIRVQYEG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  58. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380690

    Description: epitope description:RHVLGRLITVNP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  59. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380692

    Description: epitope description:RHVLGRLITVNP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  60. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380694

    Description: epitope description:PFGDSYIIIGVE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  61. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380697

    Description: epitope description:PFGDSYIIIGVE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  62. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380704

    Description: epitope description:IGQMFETTMR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  63. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380715

    Description: epitope description:KILIGVIITWIGM antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  64. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380716

    Description: epitope description:KILIGVIITWIGM antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  65. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380720

    Description: epitope description:SRSTSLSVSLVLVGVVTLYLGAMV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  66. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380725

    Description: epitope description:LDFELI antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  67. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380730

    Description: epitope description:YSMCTG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  68. B-cell epitopes in hypervariable region 1 of hepatitis C virus obtained from patients with chronic persistent hepatitis.

    ID: 1380769

    Description: epitope description:ETHVTGG antigen name:Genome polyprotein host organism:Homo sapiens antibody name:human sera

    Publication: 8890039;

  69. B-cell epitopes in hypervariable region 1 of hepatitis C virus obtained from patients with chronic persistent hepatitis.

    ID: 1380770

    Description: epitope description:THVTGGA antigen name:Genome polyprotein host organism:Homo sapiens antibody name:human sera

    Publication: 8890039;

  70. Antibodies to synthetic peptides from the preS1 region of the hepatitis B virus (HBV) envelope (env) protein are virus-neutralizing and protective.

    ID: 1380773

    Description: epitope description:PLGFFPDHQLDPAFGANSNNPDWDFNP + MYRI(G3) antigen name:Large envelope protein host organism:Oryctolagus cuniculus antibody name:Rabbi...

    Publication: 2476893;

  71. B-cell epitopes in hypervariable region 1 of hepatitis C virus obtained from patients with chronic persistent hepatitis.

    ID: 1380776

    Description: epitope description:GAAARTT antigen name:Genome polyprotein host organism:Homo sapiens antibody name:human sera

    Publication: 8890039;

  72. Antibodies to synthetic peptides from the preS1 region of the hepatitis B virus (HBV) envelope (env) protein are virus-neutralizing and protective.

    ID: 1380777

    Description: epitope description:MGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP + MYRI(G12) antigen name:Large envelope protein host organism:Pan troglodytes antibody name:C...

    Publication: 2476893;

  73. B-cell epitopes in hypervariable region 1 of hepatitis C virus obtained from patients with chronic persistent hepatitis.

    ID: 1380789

    Description: epitope description:GLTSLFT antigen name:Genome polyprotein host organism:Homo sapiens antibody name:human sera

    Publication: 8890039;

  74. B-cell epitopes in hypervariable region 1 of hepatitis C virus obtained from patients with chronic persistent hepatitis.

    ID: 1380790

    Description: epitope description:LTSLFTP antigen name:Genome polyprotein host organism:Homo sapiens antibody name:human sera

    Publication: 8890039;

  75. B-cell epitopes in hypervariable region 1 of hepatitis C virus obtained from patients with chronic persistent hepatitis.

    ID: 1380792

    Description: epitope description:SLFTPGP antigen name:Genome polyprotein host organism:Homo sapiens antibody name:human sera

    Publication: 8890039;

  76. B-cell epitopes in hypervariable region 1 of hepatitis C virus obtained from patients with chronic persistent hepatitis.

    ID: 1380794

    Description: epitope description:LFTPGPS antigen name:Genome polyprotein host organism:Homo sapiens antibody name:human sera

    Publication: 8890039;

  77. B-cell epitopes in hypervariable region 1 of hepatitis C virus obtained from patients with chronic persistent hepatitis.

    ID: 1380799

    Description: epitope description:PSQKIQL antigen name:Genome polyprotein host organism:Homo sapiens antibody name:human sera

    Publication: 8890039;

  78. B-cell epitopes in hypervariable region 1 of hepatitis C virus obtained from patients with chronic persistent hepatitis.

    ID: 1380810

    Description: epitope description:KTKRNTN antigen name:Genome polyprotein host organism:Homo sapiens antibody name:human sera

    Publication: 8890039;

  79. B-cell epitopes in hypervariable region 1 of hepatitis C virus obtained from patients with chronic persistent hepatitis.

    ID: 1380812

    Description: epitope description:KRNTNRR antigen name:Genome polyprotein host organism:Homo sapiens antibody name:human sera

    Publication: 8890039;

  80. B-cell epitopes in hypervariable region 1 of hepatitis C virus obtained from patients with chronic persistent hepatitis.

    ID: 1380814

    Description: epitope description:NTNRRPQ antigen name:Genome polyprotein host organism:Homo sapiens antibody name:human sera

    Publication: 8890039;

  81. B-cell epitopes in hypervariable region 1 of hepatitis C virus obtained from patients with chronic persistent hepatitis.

    ID: 1380817

    Description: epitope description:RRPQDVK antigen name:Genome polyprotein host organism:Homo sapiens antibody name:human sera

    Publication: 8890039;

  82. Identification of new epitopes recognized by human monoclonal antibodies with neutralizing and antibody-dependent cellular cytotoxicity activities spe...

    ID: 1380959

    Description: epitope description:TKKPNRNRNGGGYYSASYSYSDPGSLKCPYL host organism:Homo sapiens

    Publication: 1378869;

  83. Identification of new epitopes recognized by human monoclonal antibodies with neutralizing and antibody-dependent cellular cytotoxicity activities spe...

    ID: 1380962

    Description: epitope description:PCHNSLILPPFSLSPVPVPTLGSRRAVPVA host organism:Homo sapiens

    Publication: 1378869;

  84. Identification of new epitopes recognized by human monoclonal antibodies with neutralizing and antibody-dependent cellular cytotoxicity activities spe...

    ID: 1380966

    Description: epitope description:PPPPSSPTHDPPDSDPQIPPPYVEPTAPQVL antigen name:Gag-Pro-Pol polyprotein host organism:Homo sapiens antibody name:KG 27-8, KG 33-1, KG...

    Publication: 1378869;

  85. Low immunogenicity of a Plasmodium vivax circumsporozoite protein epitope bound by a protective monoclonal antibody.

    ID: 1380989

    Description: epitope description:AGDRAGDRAGDRAGDRAGDRAGDR host organism:Aotus trivirgatus antibody name:Aotus monkey sera

    Publication: 1471743;

  86. Detection of antiviral antibodies with predetermined specificity using synthetic peptide--beta-lactamase conjugates: application to antibodies specifi...

    ID: 1381163

    Description: epitope description:MQWNSTAFHQTLQDPRVRGLYLPAGG antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 2419488;

  87. Detection of antiviral antibodies with predetermined specificity using synthetic peptide--beta-lactamase conjugates: application to antibodies specifi...

    ID: 1381166

    Description: epitope description:MGTNLSVPNPLGFFPDHQLDP antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 2419488;

  88. Detection of antiviral antibodies with predetermined specificity using synthetic peptide--beta-lactamase conjugates: application to antibodies specifi...

    ID: 1381167

    Description: epitope description:MGTNLSVPNPLGFFPDHQLDP antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 2419488;

  89. Monoclonal antibodies raised to purified woodchuck hepatitis virus core antigen particles demonstrate X antigen reactivity.

    ID: 1381491

    Description: epitope description:CLFKDWEELGEEIRLKV antigen name:Protein X host organism:Mus musculus BALB/c antibody name:WC9-85

    Publication: 2353460;

  90. Functional analysis of hepatitis C virus E2 glycoproteins and virus-like particles reveals structural dissimilarities between different forms of E2.

    ID: 1381682

    Description: epitope description:QLINTNGSWHIN antigen name:Genome polyprotein host organism:Mus musculus antibody name:AP33

    Publication: 11457993;

  91. Polymerase-related polypeptides associated with woodchuck hepatitis core antigen (WHcAg) particles.

    ID: 1381736

    Description: epitope description:PVRVAWSSPVQNCEPWIPP antigen name:Protein P host organism:Mus musculus BALB/c antibody name:WCpol-11

    Publication: 1984662;

  92. Polymerase-related polypeptides associated with woodchuck hepatitis core antigen (WHcAg) particles.

    ID: 1381764

    Description: epitope description:PVRVAWSSPVQNCEPWIPP antigen name:Protein P host organism:Mus musculus

    Publication: 1984662;

  93. Immunogenicity of the Plasmodium falciparum asexual blood-stage synthetic peptide vaccine SPf66.

    ID: 1381777

    Description: epitope description:YSLFQKEKMVL antigen name:Merozoite surface protein 1 host organism:Aotus

    Publication: 7682382;

  94. Immunogenicity of the Plasmodium falciparum asexual blood-stage synthetic peptide vaccine SPf66.

    ID: 1381780

    Description: epitope description:YGGPANKKNAG antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Aotus

    Publication: 7682382;

  95. Immunogenicity of the Plasmodium falciparum asexual blood-stage synthetic peptide vaccine SPf66.

    ID: 1381807

    Description: epitope description:YSLFQKEKMVL antigen name:Merozoite surface protein 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7682382;

  96. Immunogenicity of the Plasmodium falciparum asexual blood-stage synthetic peptide vaccine SPf66.

    ID: 1381808

    Description: epitope description:YGGPANKKNAG antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Oryctolagus cuniculus ...

    Publication: 7682382;

  97. Immunogenicity of the Plasmodium falciparum asexual blood-stage synthetic peptide vaccine SPf66.

    ID: 1381811

    Description: epitope description:NANP antigen name:Circumsporozoite-related antigen host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7682382;

  98. Seroepidemiologic studies of humoral immune response to the Plasmodium falciparum antigens in Thailand.

    ID: 1381837

    Description: epitope description:EENVEENVEENVEENVEENVEENV antigen name:DNAJ protein, putative host organism:Homo sapiens

    Publication: 1449196;

  99. Genetic variation among geographic isolates of Rift Valley fever virus.

    ID: 1381840

    Description: epitope description:DCNFCRQMTGASLKKGSYPL antigen name:Rift Valley fever phlebovirus protein host organism:Mus musculus antibody name:4-39-CC

    Publication: 2462795;

  100. Plasmodium falciparum: sera of individuals living in a malaria-endemic region recognize peptide motifs of the human erythrocyte anion transport protei...

    ID: 1381849

    Description: epitope description:AITFGGLLGE antigen name:Band 3 anion transport protein host organism:Homo sapiens

    Publication: 7539597;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston