Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1474050

    Description: epitope description:GAMIKSQRQQPGGQAKKKKPEKPHFPL antigen name:Nucleoprotein host organism:Sus scrofa antibody name:Pig sera

    Publication: 16426684;

  2. Characterization of a dodecapeptide containing a dominant epitope of Par j 1 and Par o 1, the major allergens of P. judaica and P. officinalis pollen.

    ID: 1474102

    Description: epitope description:NSARARADSCRI antigen name:Parietaria officinalis protein host organism:Homo sapiens

    Publication: 10536883;

  3. Characterization of a dodecapeptide containing a dominant epitope of Par j 1 and Par o 1, the major allergens of P. judaica and P. officinalis pollen.

    ID: 1474107

    Description: epitope description:NSARVGTSSCRI antigen name:Parietaria officinalis protein host organism:Oryctolagus cuniculus

    Publication: 10536883;

  4. Role of lgtC in resistance of nontypeable Haemophilus influenzae strain R2866 to human serum.

    ID: 1474128

    Description: epitope description:N-acetyllactosamine antigen name:lipooligosaccharide host organism:Mus musculus BALB/c antibody name:3F11

    Publication: 16966407;

  5. Development of a competitive enzyme linked immunosorbent assay to identify epitope specific antibodies in recipients of the U.S. licensed anthrax vacc...

    ID: 1474139

    Description: epitope description:VHASFFDIG antigen name:Protective antigen host organism:Homo sapiens antibody name:human serum

    Publication: 17613668;

  6. Analysis of the cross-reactivity between BtM and Der p 5, two group 5 recombinant allergens from Blomia tropicalis and Dermatophagoides pteronyssinus.

    ID: 1474239

    Description: epitope description:NKSKELQEKIIRELDVVC antigen name:Blo t 5 host organism:Homo sapiens

    Publication: 9751846;

  7. Linear IgE epitope mapping of the English walnut (Juglans regia) major food allergen, Jug r 1.

    ID: 1474272

    Description: epitope description:QHFRQCCQQLSQM antigen name:Jug r 1 host organism:Homo sapiens antibody name:pooled patient sera

    Publication: 11799381;

  8. Naturally acquired immunity and reduced susceptibility to falciparum malaria in two subpopulations of endemic eastern India.

    ID: 1474281

    Description: epitope description:NSGCFRHLDEREECKCLL antigen name:Merozoite surface protein 1 host organism:Homo sapiens antibody name:Human sera

    Publication: 18086262;

  9. Linear IgE epitope mapping of the English walnut (Juglans regia) major food allergen, Jug r 1.

    ID: 1474288

    Description: epitope description:CEGLRQVVRRQQQ antigen name:Jug r 1 host organism:Homo sapiens antibody name:pooled patient sera

    Publication: 11799381;

  10. Linear IgE epitope mapping of the English walnut (Juglans regia) major food allergen, Jug r 1.

    ID: 1474307

    Description: epitope description:QNLNHCQYYLR antigen name:Jug r 1 host organism:Homo sapiens antibody name:pooled patient sera

    Publication: 11799381;

  11. Effective synthetic peptide vaccine for foot-and-mouth disease in swine.

    ID: 1474308

    Description: epitope description:NKYSASGSGVRGDFGSLAPRVARQLPASFNYGAIK antigen name:Genome polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:Gui...

    Publication: 12057619;

  12. Epitope mapping of region 11-70 of ovalbumin (Gal d I) using five synthetic peptides.

    ID: 1474321

    Description: epitope description:CFDVFKELK antigen name:Gal d 2 host organism:Homo sapiens

    Publication: 7950407;

  13. Variable linking region immunogenicity using malarial peptide carrier protein conjugates of defined composition.

    ID: 1474324

    Description: epitope description:SKYSNTFI antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Mus musculus BALB/c

    Publication: 2086458;

  14. Variable linking region immunogenicity using malarial peptide carrier protein conjugates of defined composition.

    ID: 1474326

    Description: epitope description:YSNTFINN antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Mus musculus BALB/c

    Publication: 2086458;

  15. Variable linking region immunogenicity using malarial peptide carrier protein conjugates of defined composition.

    ID: 1474329

    Description: epitope description:TFINNAYN antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Mus musculus BALB/c

    Publication: 2086458;

  16. Variable linking region immunogenicity using malarial peptide carrier protein conjugates of defined composition.

    ID: 1474330

    Description: epitope description:FINNAYNM antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Mus musculus BALB/c

    Publication: 2086458;

  17. Variable linking region immunogenicity using malarial peptide carrier protein conjugates of defined composition.

    ID: 1474332

    Description: epitope description:NNAYNMSI antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Mus musculus BALB/c

    Publication: 2086458;

  18. Variable linking region immunogenicity using malarial peptide carrier protein conjugates of defined composition.

    ID: 1474344

    Description: epitope description:EGSNTNSV antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Mus musculus BALB/c

    Publication: 2086458;

  19. Variable linking region immunogenicity using malarial peptide carrier protein conjugates of defined composition.

    ID: 1474350

    Description: epitope description:VGANAPNA antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Mus musculus BALB/c

    Publication: 2086458;

  20. Variable linking region immunogenicity using malarial peptide carrier protein conjugates of defined composition.

    ID: 1474355

    Description: epitope description:ADTIASGS antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Mus musculus BALB/c

    Publication: 2086458;

  21. Epitope mapping of region 11-70 of ovalbumin (Gal d I) using five synthetic peptides.

    ID: 1474360

    Description: epitope description:IMSALAMVYLGAK antigen name:Gal d 2 host organism:Homo sapiens

    Publication: 7950407;

  22. Epitope mapping of region 11-70 of ovalbumin (Gal d I) using five synthetic peptides.

    ID: 1474364

    Description: epitope description:VVRFDKLPGFGDSIE antigen name:Gal d 2 host organism:Homo sapiens

    Publication: 7950407;

  23. Epitope mapping of region 11-70 of ovalbumin (Gal d I) using five synthetic peptides.

    ID: 1474365

    Description: epitope description:VVRFDKLPGFGDSIE antigen name:Gal d 2 host organism:Oryctolagus cuniculus

    Publication: 7950407;

  24. Epitope mapping of region 11-70 of ovalbumin (Gal d I) using five synthetic peptides.

    ID: 1474366

    Description: epitope description:VVRFDKLPGFGDSIE antigen name:Gal d 2 host organism:Oryctolagus cuniculus

    Publication: 7950407;

  25. Effective synthetic peptide vaccine for foot-and-mouth disease in swine.

    ID: 1474391

    Description: epitope description:VYNGNCKYGENAVTNVRGDLQVLAQKAARCLPTSFNYGAIK host organism:Cavia porcellus Duncan-Hartley antibody name:Guinea pig sera

    Publication: 12057619;

  26. A virosomal malaria peptide vaccine elicits a long-lasting sporozoite-inhibitory antibody response in a phase 1a clinical trial.

    ID: 1474411

    Description: epitope description:NPNANPNANPNANPNENPNA host organism:Homo sapiens antibody name:Human sera

    Publication: 18060072;

  27. A virosomal malaria peptide vaccine elicits a long-lasting sporozoite-inhibitory antibody response in a phase 1a clinical trial.

    ID: 1474414

    Description: epitope description:NPNANPNANPNANPNENPNA host organism:Homo sapiens antibody name:Human sera

    Publication: 18060072;

  28. Linear IgE epitope mapping of the English walnut (Juglans regia) major food allergen, Jug r 1.

    ID: 1474451

    Description: epitope description:QGLRGEEMEEMV antigen name:Jug r 1 host organism:Homo sapiens antibody name:affinity-purified patient serum

    Publication: 11799381;

  29. Identifying B and T cell epitopes and studying humoral, mucosal and cellular immune responses of peptides derived from V antigen of Yersinia pestis.

    ID: 1474453

    Description: epitope description:QLVKDKNIDISIKYDPRKDSE antigen name:Virulence-associated V antigen host organism:Mus musculus antibody name:mouse serum

    Publication: 18096277;

  30. Identifying B and T cell epitopes and studying humoral, mucosal and cellular immune responses of peptides derived from V antigen of Yersinia pestis.

    ID: 1474455

    Description: epitope description:DNQLQNGIKRVKEFL antigen name:Virulence-associated V antigen host organism:Mus musculus antibody name:mouse serum

    Publication: 18096277;

  31. Identifying B and T cell epitopes and studying humoral, mucosal and cellular immune responses of peptides derived from V antigen of Yersinia pestis.

    ID: 1474456

    Description: epitope description:ESSPNTQWELRAFMA antigen name:Virulence-associated V antigen host organism:Mus musculus antibody name:mouse serum

    Publication: 18096277;

  32. Identifying B and T cell epitopes and studying humoral, mucosal and cellular immune responses of peptides derived from V antigen of Yersinia pestis.

    ID: 1474461

    Description: epitope description:LTAELKIYSVIQAEINKHL antigen name:Virulence-associated V antigen host organism:Mus musculus antibody name:mouse serum

    Publication: 18096277;

  33. Identifying B and T cell epitopes and studying humoral, mucosal and cellular immune responses of peptides derived from V antigen of Yersinia pestis.

    ID: 1474466

    Description: epitope description:DNQLQNGIKRVKEFL antigen name:Virulence-associated V antigen host organism:Oryctolagus cuniculus antibody name:rabbit serum

    Publication: 18096277;

  34. Identifying B and T cell epitopes and studying humoral, mucosal and cellular immune responses of peptides derived from V antigen of Yersinia pestis.

    ID: 1474474

    Description: epitope description:TTCSDKSRPLNDLVS antigen name:Virulence-associated V antigen host organism:Oryctolagus cuniculus antibody name:rabbit serum

    Publication: 18096277;

  35. Identifying B and T cell epitopes and studying humoral, mucosal and cellular immune responses of peptides derived from V antigen of Yersinia pestis.

    ID: 1474487

    Description: epitope description:QLVKDKNIDISIKYDPRKDSE antigen name:Virulence-associated V antigen host organism:Mus musculus antibody name:mouse serum

    Publication: 18096277;

  36. Identifying B and T cell epitopes and studying humoral, mucosal and cellular immune responses of peptides derived from V antigen of Yersinia pestis.

    ID: 1474492

    Description: epitope description:GSENKRTGALGNLKN antigen name:Virulence-associated V antigen host organism:Mus musculus antibody name:mouse serum

    Publication: 18096277;

  37. Identifying B and T cell epitopes and studying humoral, mucosal and cellular immune responses of peptides derived from V antigen of Yersinia pestis.

    ID: 1474508

    Description: epitope description:ISIKYDPRKDSEVFA antigen name:Virulence-associated V antigen host organism:Mus musculus antibody name:mouse serum

    Publication: 18096277;

  38. Identifying B and T cell epitopes and studying humoral, mucosal and cellular immune responses of peptides derived from V antigen of Yersinia pestis.

    ID: 1474511

    Description: epitope description:LTAELKIYSVIQAEINKHL antigen name:Virulence-associated V antigen host organism:Mus musculus antibody name:mouse serum

    Publication: 18096277;

  39. Identifying B and T cell epitopes and studying humoral, mucosal and cellular immune responses of peptides derived from V antigen of Yersinia pestis.

    ID: 1474529

    Description: epitope description:DIELLKKILAGGFIQKYDSVMQ host organism:Mus musculus antibody name:mouse serum

    Publication: 18096277;

  40. Identifying B and T cell epitopes and studying humoral, mucosal and cellular immune responses of peptides derived from V antigen of Yersinia pestis.

    ID: 1474532

    Description: epitope description:EYKILEKMPQTTIQVDGSEKKI antigen name:Virulence-associated V antigen host organism:Mus musculus antibody name:mouse serum

    Publication: 18096277;

  41. Identifying B and T cell epitopes and studying humoral, mucosal and cellular immune responses of peptides derived from V antigen of Yersinia pestis.

    ID: 1474533

    Description: epitope description:TTCSDKSRPLNDLVS antigen name:Virulence-associated V antigen host organism:Mus musculus antibody name:mouse serum

    Publication: 18096277;

  42. Identifying B and T cell epitopes and studying humoral, mucosal and cellular immune responses of peptides derived from V antigen of Yersinia pestis.

    ID: 1474534

    Description: epitope description:VMHFSLTADRGGELKIYSVIQA host organism:Mus musculus antibody name:mouse serum

    Publication: 18096277;

  43. Identifying B and T cell epitopes and studying humoral, mucosal and cellular immune responses of peptides derived from V antigen of Yersinia pestis.

    ID: 1474542

    Description: epitope description:ESSPNTQWELRAFMA antigen name:Virulence-associated V antigen host organism:Mus musculus BALB/c antibody name:mouse serum

    Publication: 18096277;

  44. Identifying B and T cell epitopes and studying humoral, mucosal and cellular immune responses of peptides derived from V antigen of Yersinia pestis.

    ID: 1474544

    Description: epitope description:TTCSDKSRPLNDLVS antigen name:Virulence-associated V antigen host organism:Mus musculus BALB/c antibody name:mouse serum

    Publication: 18096277;

  45. Identifying B and T cell epitopes and studying humoral, mucosal and cellular immune responses of peptides derived from V antigen of Yersinia pestis.

    ID: 1474546

    Description: epitope description:QLVKDKNIDISIKYDPRKDSE antigen name:Virulence-associated V antigen host organism:Mus musculus antibody name:mouse serum

    Publication: 18096277;

  46. Identifying B and T cell epitopes and studying humoral, mucosal and cellular immune responses of peptides derived from V antigen of Yersinia pestis.

    ID: 1474549

    Description: epitope description:ISIKYDPRKDSEVFA antigen name:Virulence-associated V antigen host organism:Mus musculus BALB/c antibody name:mouse serum

    Publication: 18096277;

  47. Identifying B and T cell epitopes and studying humoral, mucosal and cellular immune responses of peptides derived from V antigen of Yersinia pestis.

    ID: 1474554

    Description: epitope description:DNQLQNGIKRVKEFL antigen name:Virulence-associated V antigen host organism:Mus musculus BALB/c antibody name:mouse serum

    Publication: 18096277;

  48. Identifying B and T cell epitopes and studying humoral, mucosal and cellular immune responses of peptides derived from V antigen of Yersinia pestis.

    ID: 1474555

    Description: epitope description:ESSPNTQWELRAFMA antigen name:Virulence-associated V antigen host organism:Mus musculus BALB/c antibody name:mouse serum

    Publication: 18096277;

  49. Identifying B and T cell epitopes and studying humoral, mucosal and cellular immune responses of peptides derived from V antigen of Yersinia pestis.

    ID: 1474557

    Description: epitope description:TTCSDKSRPLNDLVS antigen name:Virulence-associated V antigen host organism:Mus musculus BALB/c antibody name:mouse serum

    Publication: 18096277;

  50. IgE epitopes on the cat (Felis domesticus) major allergen Fel d I: a study with overlapping synthetic peptides.

    ID: 1474942

    Description: epitope description:DAKMTEEDKENALS antigen name:Fel d 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 7508463;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston