Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Biochemical and immunological studies of nucleocapsid proteins of severe acute respiratory syndrome and 229E human coronaviruses.

    ID: 1245843

    Description: epitope description:VTQAFGRRGPEQTQGNFGDQ antigen name:Nucleoprotein host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit anti-N ...

    Publication: 15759315;

  2. New methods using polyvinylidene difluoride membranes to detect enzymes involved in glycosphingolipid metabolism.

    ID: 1245881

    Description: epitope description:beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-D-Galp antigen name:alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc host organism...

    Publication: 8678291;

  3. Development of a plant-derived subunit vaccine candidate against hepatitis C virus.

    ID: 1245888

    Description: epitope description:QTTVVGGSQSHTVRGLTSLFSPGASQN host organism:Homo sapiens

    Publication: 11205105;

  4. Development of a plant-derived subunit vaccine candidate against hepatitis C virus.

    ID: 1245900

    Description: epitope description:QTTVVGGSQSHTVRGLTSLFSPGASQN host organism:Mus musculus C57BL/6

    Publication: 11205105;

  5. Vaccination with the recombinant Brucella outer membrane protein 31 or a derived 27-amino-acid synthetic peptide elicits a CD4+ T helper 1 response th...

    ID: 1246085

    Description: epitope description:NAGYAGGKFKHPFSSFDKEDNEQVSGS antigen name:31 kDa outer-membrane immunogenic protein host organism:Mus musculus BALB/c

    Publication: 16299302;

  6. Effect of saccharide length on the immunogenicity of neoglycoconjugates from synthetic fragments of the O-SP of Vibrio cholerae O1, serotype Ogawa.

    ID: 1246102

    Description: epitope description:4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-alpha-D-Manp2Me-(1->2)-4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-alpha-D-ManpOMe...

    Publication: 16098493;

  7. Effect of saccharide length on the immunogenicity of neoglycoconjugates from synthetic fragments of the O-SP of Vibrio cholerae O1, serotype Ogawa.

    ID: 1246116

    Description: epitope description:4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-alpha-D-Manp2Me-(1->2)-4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-alpha-D-Manp-(1...

    Publication: 16098493;

  8. Effect of saccharide length on the immunogenicity of neoglycoconjugates from synthetic fragments of the O-SP of Vibrio cholerae O1, serotype Ogawa.

    ID: 1246118

    Description: epitope description:4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-alpha-D-Manp2Me-(1->2)-4,6-dideoxy-4-(3-deoxy-L-glycero-tetronamido)-alpha-D-Manp-(1...

    Publication: 16098493;

  9. Glycoproteins E2 of the Venezuelan and eastern equine encephalomyelitis viruses contain multiple cross-reactive epitopes.

    ID: 1246142

    Description: epitope description:G406, A440, D442 antigen name:Structural polyprotein host organism:Mus musculus antibody name:5H6

    Publication: 8973533;

  10. Glycoproteins E2 of the Venezuelan and eastern equine encephalomyelitis viruses contain multiple cross-reactive epitopes.

    ID: 1246143

    Description: epitope description:S514, S516 antigen name:Structural polyprotein host organism:Mus musculus antibody name:5A12

    Publication: 8973533;

  11. Glycoproteins E2 of the Venezuelan and eastern equine encephalomyelitis viruses contain multiple cross-reactive epitopes.

    ID: 1246144

    Description: epitope description:K549 antigen name:Structural polyprotein host organism:Mus musculus antibody name:3E11

    Publication: 8973533;

  12. Glycoproteins E2 of the Venezuelan and eastern equine encephalomyelitis viruses contain multiple cross-reactive epitopes.

    ID: 1246154

    Description: epitope description:S532, S533 antigen name:Structural polyprotein host organism:Mus musculus antibody name:2D4

    Publication: 8973533;

  13. Semliki Forest virus E2 envelope epitopes induce a nonneutralizing humoral response which protects mice against lethal challenge.

    ID: 1246342

    Description: epitope description:QVSIQDTRNAVRACRIQYHHDPQPVGREKFTIRPHYGK antigen name:Structural polyprotein host organism:Mus musculus

    Publication: 2473217;

  14. Semliki Forest virus E2 envelope epitopes induce a nonneutralizing humoral response which protects mice against lethal challenge.

    ID: 1246395

    Description: epitope description:KITVGGKKVKYNCTCGTGNVGTTNSDM antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 2473217;

  15. Semliki Forest virus E2 envelope epitopes induce a nonneutralizing humoral response which protects mice against lethal challenge.

    ID: 1246396

    Description: epitope description:KITVGGKKVKYNCTCGTGNVGTTNSDM antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 2473217;

  16. Precise location of sequential dengue virus subcomplex and complex B cell epitopes on the nonstructural-1 glycoprotein.

    ID: 1246411

    Description: epitope description:TRLENLMWK + NAc(T1) antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:5H4.3

    Publication: 7944953;

  17. Precise location of sequential dengue virus subcomplex and complex B cell epitopes on the nonstructural-1 glycoprotein.

    ID: 1246413

    Description: epitope description:TRLENLMWK + NAc(T1) antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:5H4.3

    Publication: 7944953;

  18. Precise location of sequential dengue virus subcomplex and complex B cell epitopes on the nonstructural-1 glycoprotein.

    ID: 1246415

    Description: epitope description:TRLENLMWK + NAc(T1) antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:5H4.3

    Publication: 7944953;

  19. Precise location of sequential dengue virus subcomplex and complex B cell epitopes on the nonstructural-1 glycoprotein.

    ID: 1246426

    Description: epitope description:RTTTASGKLIT + NAc(R1) antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:5H5.4, 1G5.3

    Publication: 7944953;

  20. Precise location of sequential dengue virus subcomplex and complex B cell epitopes on the nonstructural-1 glycoprotein.

    ID: 1246445

    Description: epitope description:LRYSWKTWGKA + NAc(L1) antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:3D1.4, 4H3.4, 3A5.4, 1A12.3

    Publication: 7944953;

  21. Use of recombinant fusion proteins and monoclonal antibodies to define linear and discontinuous antigenic sites on the dengue virus envelope glycoprot...

    ID: 1246594

    Description: epitope description:NKPTLDFELI antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:E2A10

    Publication: 1372140;

  22. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267403

    Description: epitope description:ATFQVE antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTP7

    Publication: 1715029;

  23. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267404

    Description: epitope description:TFQVEV antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTP7

    Publication: 1715029;

  24. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267405

    Description: epitope description:FQVEVP antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTP7

    Publication: 1715029;

  25. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267408

    Description: epitope description:HIDSQK antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTP7

    Publication: 1715029;

  26. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267417

    Description: epitope description:TPQNIT antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  27. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267431

    Description: epitope description:QIHTLN antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  28. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267433

    Description: epitope description:HTLNNK antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  29. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267437

    Description: epitope description:NKIFSY antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  30. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267446

    Description: epitope description:AGKREM antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  31. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267451

    Description: epitope description:MAIITF antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  32. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267453

    Description: epitope description:IITFKN antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  33. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267460

    Description: epitope description:ATFQVE antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  34. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267463

    Description: epitope description:QVEVPG antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  35. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267469

    Description: epitope description:SQHIDS antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  36. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267470

    Description: epitope description:QHIDSQ antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  37. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267471

    Description: epitope description:IDSQKK antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  38. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267473

    Description: epitope description:SQKKAI antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  39. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267475

    Description: epitope description:IERMKD antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  40. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267477

    Description: epitope description:KDTLRI antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  41. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267478

    Description: epitope description:DTLRIA antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  42. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267481

    Description: epitope description:RIAYLT antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  43. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267492

    Description: epitope description:KLCVWN antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  44. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267494

    Description: epitope description:CVWNNK antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  45. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267500

    Description: epitope description:TPHAIA antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  46. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267506

    Description: epitope description:QNITDL antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  47. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267507

    Description: epitope description:TQIHTL antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  48. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267508

    Description: epitope description:FSYTES antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  49. Mapping epitopic regions of cholera toxin B-subunit protein.

    ID: 1267509

    Description: epitope description:HIDSQK antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus antibody name:Anti-CTB-1

    Publication: 1715029;

  50. Characterization of smooth Brucella lipopolysaccharides and polysaccharides by monoclonal antibodies.

    ID: 1267519

    Description: epitope description:Brucella sp. O-PS M-antigen antigen name:polysaccharide host organism:Mus musculus BALB/c antibody name:BmE10-5

    Publication: 1805311;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston