Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Antibody reactivity to an Epstein-Barr virus BERF4-encoded epitope occurring also in Asp-57 region of HLA-DQ8 beta chain. Childhood Diabetes in Finlan...

    ID: 1379498

    Description: epitope description:GRPVA antigen name:HLA class II histocompatibility antigen, DRB1-7 beta chain host organism:Homo sapiens

    Publication: 7508347;

  2. Antibody reactivity to an Epstein-Barr virus BERF4-encoded epitope occurring also in Asp-57 region of HLA-DQ8 beta chain. Childhood Diabetes in Finlan...

    ID: 1379511

    Description: epitope description:GRLDA antigen name:HLA class II histocompatibility antigen, DQ beta 1 chain (UniProt:P01920) host organism:Homo sapiens

    Publication: 7508347;

  3. Antibody reactivity to an Epstein-Barr virus BERF4-encoded epitope occurring also in Asp-57 region of HLA-DQ8 beta chain. Childhood Diabetes in Finlan...

    ID: 1379512

    Description: epitope description:GPPAAGPPAAGPPAA antigen name:Epstein-Barr nuclear antigen 6 host organism:Homo sapiens

    Publication: 7508347;

  4. Antibody reactivity to an Epstein-Barr virus BERF4-encoded epitope occurring also in Asp-57 region of HLA-DQ8 beta chain. Childhood Diabetes in Finlan...

    ID: 1379517

    Description: epitope description:GPPAAEYWNSQ antigen name:HLA class II histocompatibility antigen, DQ beta 1 chain (UniProt:P01920) host organism:Oryctolagus cunic...

    Publication: 7508347;

  5. Antibody reactivity to an Epstein-Barr virus BERF4-encoded epitope occurring also in Asp-57 region of HLA-DQ8 beta chain. Childhood Diabetes in Finlan...

    ID: 1379526

    Description: epitope description:TPLGPPAAEYW antigen name:HLA class II histocompatibility antigen, DQ beta 1 chain (UniProt:P01920) host organism:Homo sapiens

    Publication: 7508347;

  6. Antibody reactivity to an Epstein-Barr virus BERF4-encoded epitope occurring also in Asp-57 region of HLA-DQ8 beta chain. Childhood Diabetes in Finlan...

    ID: 1379530

    Description: epitope description:GPPAAEYGPPAAEY host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7508347;

  7. Recognition of synthetic 104-mer and 102-mer peptides corresponding to N- and C-terminal nonrepeat regions of the Plasmodium falciparum circumsporozoi...

    ID: 1379535

    Description: epitope description:DNAGTNLYNELEMNYYGKQENWYSLKKNSRSLGENDDGNNN antigen name:Circumsporozoite (CS) protein host organism:Homo sapiens antibody name:Huma...

    Publication: 8916800;

  8. Recognition of synthetic 104-mer and 102-mer peptides corresponding to N- and C-terminal nonrepeat regions of the Plasmodium falciparum circumsporozoi...

    ID: 1379537

    Description: epitope description:KNNQGNGQGHNMPNDPNRNVDENANANN antigen name:Circumsporozoite (CS) protein host organism:Homo sapiens antibody name:Human sera

    Publication: 8916800;

  9. Recognition of synthetic 104-mer and 102-mer peptides corresponding to N- and C-terminal nonrepeat regions of the Plasmodium falciparum circumsporozoi...

    ID: 1379538

    Description: epitope description:NAVKNNNNEEPSDKHIEQYLKKIKNSISTEW antigen name:Circumsporozoite (CS) protein host organism:Homo sapiens antibody name:Human sera

    Publication: 8916800;

  10. Antibody reactivity to an Epstein-Barr virus BERF4-encoded epitope occurring also in Asp-57 region of HLA-DQ8 beta chain. Childhood Diabetes in Finlan...

    ID: 1379539

    Description: epitope description:TPQGRPVAEYW antigen name:HLA class II histocompatibility antigen, DQ beta 1 chain (UniProt:P01920) host organism:Homo sapiens

    Publication: 7508347;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston