Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.
ID: 1481087
Description: epitope description:NNEMDETINKLKKDINKLNEKIEKYDNFMKM antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Ho...
Publication: 17653272;Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.
ID: 1481090
Description: epitope description:NNVIRSKMYNIKKRISKINDELHELSNFFL antigen name:Uncharacterized protein PFB0460c host organism:Homo sapiens antibody name:Human sera
Publication: 17653272;Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.
ID: 1481093
Description: epitope description:TYTLSKLNNQINELTKKINILRGNLDKARK antigen name:Uncharacterized protein PFL1235c host organism:Homo sapiens antibody name:Human sera
Publication: 17653272;Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.
ID: 1481108
Description: epitope description:KLEEMKQKNKELINNLNDISDELKNCIEQVNSVSRNMANVEK antigen name:Uncharacterized protein PFB0765w host organism:Homo sapiens antibody name:...
Publication: 17653272;Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.
ID: 1481110
Description: epitope description:TLIDSFNLNLSYLRESINNKKKHINKIND antigen name:RING finger protein PFE0100w host organism:Homo sapiens antibody name:Human sera
Publication: 17653272;Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.
ID: 1481112
Description: epitope description:EKLYILEKSINKLKKLLNDINNKYQTIKK antigen name:Reticulocyte-binding protein 3 host organism:Homo sapiens antibody name:Human sera
Publication: 17653272;Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.
ID: 1481123
Description: epitope description:NVLEYAELIIDRQRDKINELEKKLEELRSSSEELQKNVIK antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host or...
Publication: 17653272;Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.
ID: 1481124
Description: epitope description:NVLEYAELIIDRQRDKINELEKKLEELRSSSEELQKNVIK antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host or...
Publication: 17653272;Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.
ID: 1481126
Description: epitope description:GIFIYNMNLLREILKLMTDNIDTLKDKINEIKCSYAFLK antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host org...
Publication: 17653272;Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.
ID: 1481127
Description: epitope description:NFVNNYINENILNLKSVDNYLEKINNKIKDLDDNINDR antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host orga...
Publication: 17653272;Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.
ID: 1481134
Description: epitope description:EKGLKSLNEKIKNYDSIIEEQKNQLENLKM antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Hom...
Publication: 17653272;ID: 1481142
Description: epitope description:RSRSES antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-Peptide 1
Publication: 2984231;ID: 1481180
Description: epitope description:STTNKDK antigen name:Genome polyprotein host organism:Rattus norvegicus Lewis antibody name:anti-Peptide 2
Publication: 2984231;ID: 1481190
Description: epitope description:DNPASTTNKDK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-Peptide 3
Publication: 2984231;ID: 1481192
Description: epitope description:DNPASTTNKDK antigen name:Genome polyprotein host organism:Cavia porcellus Hartley antibody name:anti-Peptide 3
Publication: 2984231;Analysis of the functional domains of Arcanobacterium pyogenes pyolysin using monoclonal antibodies.
ID: 1481237
Description: epitope description:ARNIHVEAGEATGLAWDPWWTVINK antigen name:Alveolysin host organism:Mus musculus BALB/c antibody name:G, C
Publication: 11390107;ID: 1481255
Description: epitope description:LQAMRKYSPFRNGYMEPTLG antigen name:Protein Tax-1 host organism:Homo sapiens
Publication: 7496941;ID: 1481257
Description: epitope description:HEPQISPGGLEPPSEKHFRE antigen name:Protein Tax-1 host organism:Homo sapiens
Publication: 7496941;ID: 1481317
Description: epitope description:AGVRRGDLAHLAAAHARHLP antigen name:Polyprotein host organism:Bos taurus Hereford
Publication: 9060612;ID: 1481370
Description: epitope description:ETQTQRRHHTDVAFVLDRFVAGARRGDLAHLAAAHARHLP host organism:Bos taurus Friesian
Publication: 9060612;