Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.

    ID: 1481087

    Description: epitope description:NNEMDETINKLKKDINKLNEKIEKYDNFMKM antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Ho...

    Publication: 17653272;

  2. Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.

    ID: 1481090

    Description: epitope description:NNVIRSKMYNIKKRISKINDELHELSNFFL antigen name:Uncharacterized protein PFB0460c host organism:Homo sapiens antibody name:Human sera

    Publication: 17653272;

  3. Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.

    ID: 1481093

    Description: epitope description:TYTLSKLNNQINELTKKINILRGNLDKARK antigen name:Uncharacterized protein PFL1235c host organism:Homo sapiens antibody name:Human sera

    Publication: 17653272;

  4. Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.

    ID: 1481108

    Description: epitope description:KLEEMKQKNKELINNLNDISDELKNCIEQVNSVSRNMANVEK antigen name:Uncharacterized protein PFB0765w host organism:Homo sapiens antibody name:...

    Publication: 17653272;

  5. Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.

    ID: 1481110

    Description: epitope description:TLIDSFNLNLSYLRESINNKKKHINKIND antigen name:RING finger protein PFE0100w host organism:Homo sapiens antibody name:Human sera

    Publication: 17653272;

  6. Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.

    ID: 1481112

    Description: epitope description:EKLYILEKSINKLKKLLNDINNKYQTIKK antigen name:Reticulocyte-binding protein 3 host organism:Homo sapiens antibody name:Human sera

    Publication: 17653272;

  7. Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.

    ID: 1481123

    Description: epitope description:NVLEYAELIIDRQRDKINELEKKLEELRSSSEELQKNVIK antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host or...

    Publication: 17653272;

  8. Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.

    ID: 1481124

    Description: epitope description:NVLEYAELIIDRQRDKINELEKKLEELRSSSEELQKNVIK antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host or...

    Publication: 17653272;

  9. Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.

    ID: 1481126

    Description: epitope description:GIFIYNMNLLREILKLMTDNIDTLKDKINEIKCSYAFLK antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host org...

    Publication: 17653272;

  10. Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.

    ID: 1481127

    Description: epitope description:NFVNNYINENILNLKSVDNYLEKINNKIKDLDDNINDR antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host orga...

    Publication: 17653272;

  11. Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.

    ID: 1481134

    Description: epitope description:EKGLKSLNEKIKNYDSIIEEQKNQLENLKM antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Hom...

    Publication: 17653272;

  12. The immune response to poliovirus-specific synthetic peptides: effects of adjuvants and test animal species.

    ID: 1481142

    Description: epitope description:RSRSES antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-Peptide 1

    Publication: 2984231;

  13. The immune response to poliovirus-specific synthetic peptides: effects of adjuvants and test animal species.

    ID: 1481180

    Description: epitope description:STTNKDK antigen name:Genome polyprotein host organism:Rattus norvegicus Lewis antibody name:anti-Peptide 2

    Publication: 2984231;

  14. The immune response to poliovirus-specific synthetic peptides: effects of adjuvants and test animal species.

    ID: 1481190

    Description: epitope description:DNPASTTNKDK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-Peptide 3

    Publication: 2984231;

  15. The immune response to poliovirus-specific synthetic peptides: effects of adjuvants and test animal species.

    ID: 1481192

    Description: epitope description:DNPASTTNKDK antigen name:Genome polyprotein host organism:Cavia porcellus Hartley antibody name:anti-Peptide 3

    Publication: 2984231;

  16. Analysis of the functional domains of Arcanobacterium pyogenes pyolysin using monoclonal antibodies.

    ID: 1481237

    Description: epitope description:ARNIHVEAGEATGLAWDPWWTVINK antigen name:Alveolysin host organism:Mus musculus BALB/c antibody name:G, C

    Publication: 11390107;

  17. Detection of antibodies to trans-activator protein (p40taxI) of human T-cell lymphotropic virus type I by a synthetic peptide-based assay.

    ID: 1481255

    Description: epitope description:LQAMRKYSPFRNGYMEPTLG antigen name:Protein Tax-1 host organism:Homo sapiens

    Publication: 7496941;

  18. Detection of antibodies to trans-activator protein (p40taxI) of human T-cell lymphotropic virus type I by a synthetic peptide-based assay.

    ID: 1481257

    Description: epitope description:HEPQISPGGLEPPSEKHFRE antigen name:Protein Tax-1 host organism:Homo sapiens

    Publication: 7496941;

  19. A large-scale evaluation of peptide vaccines against foot-and-mouth disease: lack of solid protection in cattle and isolation of escape mutants.

    ID: 1481317

    Description: epitope description:AGVRRGDLAHLAAAHARHLP antigen name:Polyprotein host organism:Bos taurus Hereford

    Publication: 9060612;

  20. A large-scale evaluation of peptide vaccines against foot-and-mouth disease: lack of solid protection in cattle and isolation of escape mutants.

    ID: 1481370

    Description: epitope description:ETQTQRRHHTDVAFVLDRFVAGARRGDLAHLAAAHARHLP host organism:Bos taurus Friesian

    Publication: 9060612;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston