Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "
  1. Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

    ID: 1481845

    Description: epitope description:AELKSALQSCSAEPLDDDHVKAFLDK antigen name:Immunogenic protein host organism:Homo sapiens

    Publication: 17403055;
  2. Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

    ID: 1481846

    Description: epitope description:HVKAFLDKLDSNKDGELSLDELMALF antigen name:Immunogenic protein host organism:Homo sapiens

    Publication: 17403055;
  3. Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

    ID: 1481860

    Description: epitope description:ELKSALQSCSAEPLDDDHVKAFLDKLDSNKDGELSLDELMALF antigen name:Immunogenic protein host organism:Homo sapiens

    Publication: 17403055;
  4. Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

    ID: 1481866

    Description: epitope description:CVCRSCRTMSLQKTVEKLFDELDKDKSGKISCAELKSALQ antigen name:Immunogenic protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 17403055;
  5. Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

    ID: 1481875

    Description: epitope description:DKLDSNKDGELSLDELMALF antigen name:Immunogenic protein host organism:Mus musculus BALB/c

    Publication: 17403055;
  6. Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

    ID: 1481876

    Description: epitope description:ELDKDKSGKISCAELKSALQSCSAEPLDDDH antigen name:Immunogenic protein host organism:Mus musculus BALB/c

    Publication: 17403055;
  7. Identification of a diagnostic antibody-binding region on the immunogenic protein EpC1 from Echinococcus granulosus and its application in population ...

    ID: 1481879

    Description: epitope description:ELKSALQSCSAEPLDDDHVKAFLDKLDSNKDGELSLDELMALF antigen name:Immunogenic protein host organism:Mus musculus BALB/c

    Publication: 17403055;
  8. An epitope located at the C terminus of isolated VP1 of foot-and-mouth disease virus type O induces neutralizing activity but poor protection.

    ID: 1481882

    Description: epitope description:GDLQVLA antigen name:Polyprotein host organism:Oryctolagus cuniculus antibody name:anti-146-152

    Publication: 2418152;
  9. An epitope located at the C terminus of isolated VP1 of foot-and-mouth disease virus type O induces neutralizing activity but poor protection.

    ID: 1481908

    Description: epitope description:RHKQKIVAPVK antigen name:Polyprotein host organism:Mus musculus BALB/c antibody name:MCA a-A

    Publication: 2418152;
  10. Immunogenicity of variable regions of the surface envelope glycoprotein of HTLV type I and identification of new major epitopes in the 239-261 region.

    ID: 1481930

    Description: epitope description:VLYSPNVSVPSSSSTPLLYPSLA antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8798979;
  11. A chimaeric plant virus vaccine protects mice against a bacterial infection.

    ID: 1481958

    Description: epitope description:NEYGVEGGRVNAVGSGDNATAEGRAINRRVEAEV host organism:Mus musculus ICR

    Publication: 10463172;
  12. Characterization of monoclonal antibodies raised against recombinant respiratory syncytial virus nucleocapsid (N) protein: identification of a region ...

    ID: 1481969

    Description: epitope description:LYDAAKAYAEQLKENGVINY antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:alphaN002, alphaN003 and alphaN014

    Publication: 11689048;
  13. Epitope mapping of foot-and-mouth disease virus with neutralizing monoclonal antibodies.

    ID: 1481980

    Description: epitope description:SKYSAGGTGRRGDLGPLAARVAAQLP antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:anti-Peptide 135-16...

    Publication: 2471783;
  14. Antigenicity and immunogenicity of synthetic peptides of foot-and-mouth disease virus.

    ID: 1482000

    Description: epitope description:LVRMKRA antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:18

    Publication: 2434606;
  15. Antigenicity and immunogenicity of synthetic peptides of foot-and-mouth disease virus.

    ID: 1482003

    Description: epitope description:LVRMKRA antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 2434606;
  16. Antigenicity and immunogenicity of synthetic peptides of foot-and-mouth disease virus.

    ID: 1482021

    Description: epitope description:YKQKIIAP antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:18

    Publication: 2434606;
  17. An in vitro selected binding protein (affibody) shows conformation-dependent recognition of the respiratory syncytial virus (RSV) G protein.

    ID: 1482044

    Description: epitope description:TKKPTFKTTKKDHKPQTTKPKEVPTTKP antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:8D3

    Publication: 10231093;
  18. Chimeric foot-and-mouth disease viruses: evaluation of their efficacy as potential marker vaccines in cattle.

    ID: 1482048

    Description: epitope description:KYSASGSGVRGDFGSLAPRVAR antigen name:Genome polyprotein host organism:Bos taurus Holstein-Friesian

    Publication: 18342409;
  19. A peptide construct containing B-cell and T-cell epitopes from the foot-and-mouth disease viral VP1 protein induces efficient antiviral protection.

    ID: 1482053

    Description: epitope description:KYSAGGMGRRGDLEPLAARVAAQL antigen name:Genome polyprotein host organism:Mus musculus C57BL/6

    Publication: 10075164;
  20. Analysis of neutralizing epitopes on foot-and-mouth disease virus.

    ID: 1482055

    Description: epitope description:LRGDLQVLAQKVARTL antigen name:Polyprotein host organism:Oryctolagus cuniculus antibody name:anti-peptide A

    Publication: 2835507;

Displaying 20 of 1,510,353 results for " "