Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 5 of 1,510,353 results for " "
  1. Detection of the myristylated gag-raf transforming protein with raf-specific antipeptide sera.

    ID: 1465815

    Description: epitope description:CTLTTSPRLPVF antigen name:MOS host organism:Oryctolagus cuniculus

    Publication: 2994296;
  2. Protection against foot-and-mouth disease by immunization with a chemically synthesized peptide predicted from the viral nucleotide sequence.

    ID: 1465819

    Description: epitope description:TTSAGESADPVTTTVENYGGETQIQRRQHTDVSFIMDRFVK antigen name:Polyprotein host organism:Oryctolagus cuniculus antibody name:Anti-peptide ...

    Publication: 7045684;
  3. Protection against foot-and-mouth disease by immunization with a chemically synthesized peptide predicted from the viral nucleotide sequence.

    ID: 1465831

    Description: epitope description:NYGGETQIQRRQHTDV antigen name:Polyprotein host organism:Oryctolagus cuniculus antibody name:Anti-peptide 17-32 sera

    Publication: 7045684;
  4. Protection against foot-and-mouth disease by immunization with a chemically synthesized peptide predicted from the viral nucleotide sequence.

    ID: 1465839

    Description: epitope description:VPNLRGDLQVLAQKVARTLP antigen name:Polyprotein host organism:Oryctolagus cuniculus antibody name:Anti-peptide 141-160 sera

    Publication: 7045684;
  5. Segregation of B and T cell epitopes of Treponema pallidum repeat protein K to variable and conserved regions during experimental syphilis infection.

    ID: 1465882

    Description: epitope description:ELAWGIASDGGALKHGFKTT antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit antise...

    Publication: 12097401;

Displaying 5 of 1,510,353 results for " "