Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Mapping of a conformational epitope shared between E1 and E2 on the serum-derived human hepatitis C virus envelope.

    ID: 1274558

    Description: epitope description:R297, H298, W299, T300, T301, Q302, G303, C304, N305, C306, P480, D481, Q482, R483, P484, Y485, C486, W487, H488, Y489, P490, P491...

    Publication: 12882983;

  2. Identification of two immunogenic domains of the prion protein--PrP--which activate class II-restricted T cells and elicit antibody responses against ...

    ID: 1274610

    Description: epitope description:NQVYYRPVDQYSNQNNFVHDCVNITIKQHT antigen name:Major prion protein host organism:Mus musculus PrP null

    Publication: 15075357;

  3. Selective and efficient immunoprecipitation of the disease-associated form of the prion protein can be mediated by nonspecific interactions between mo...

    ID: 1274623

    Description: epitope description:YEDRYYRE antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:SHA-31

    Publication: 15140886;

  4. Detection of species specific epitopes of mouse and hamster prion proteins (PrPs) by anti-peptide antibodies.

    ID: 1274658

    Description: epitope description:KPSKPKTNMKHMAGAA antigen name:Mesocricetus auratus (Syrian golden hamster) protein host organism:Oryctolagus cuniculus antibody na...

    Publication: 8645112;

  5. Detection of species specific epitopes of mouse and hamster prion proteins (PrPs) by anti-peptide antibodies.

    ID: 1274660

    Description: epitope description:ETDVKMMERV antigen name:Major prion protein host organism:Oryctolagus cuniculus antibody name:Ab. Mo-V

    Publication: 8645112;

  6. Detection of species specific epitopes of mouse and hamster prion proteins (PrPs) by anti-peptide antibodies.

    ID: 1274661

    Description: epitope description:ETDVKMMERV antigen name:Major prion protein host organism:Oryctolagus cuniculus antibody name:Ab. Mo-V

    Publication: 8645112;

  7. Preparation and characterization of antibodies against mouse prion protein (PrP) peptides.

    ID: 1274730

    Description: epitope description:VDQYSNQNNF antigen name:Major prion protein host organism:Oryctolagus cuniculus antibody name:Ab165-174

    Publication: 7535178;

  8. Preparation and characterization of antibodies against mouse prion protein (PrP) peptides.

    ID: 1274738

    Description: epitope description:CVTQYQKESQAYYD antigen name:Major prion protein host organism:Oryctolagus cuniculus antibody name:Ab213-226

    Publication: 7535178;

  9. Selection of antigenic and immunogenic mimics of hepatitis C virus using sera from patients.

    ID: 1274745

    Description: epitope description:PTHYISTSL host organism:Homo sapiens

    Publication: 8666827;

  10. Selection of antigenic and immunogenic mimics of hepatitis C virus using sera from patients.

    ID: 1274746

    Description: epitope description:PSHYVPRIY host organism:Homo sapiens

    Publication: 8666827;

  11. Selection of antigenic and immunogenic mimics of hepatitis C virus using sera from patients.

    ID: 1274749

    Description: epitope description:PTHYISSRH host organism:Mus musculus BALB/c

    Publication: 8666827;

  12. Selection of antigenic and immunogenic mimics of hepatitis C virus using sera from patients.

    ID: 1274752

    Description: epitope description:NKTKQNPNL host organism:Mus musculus BALB/c

    Publication: 8666827;

  13. Selection of antigenic and immunogenic mimics of hepatitis C virus using sera from patients.

    ID: 1274753

    Description: epitope description:NKTKQNPNL host organism:Homo sapiens

    Publication: 8666827;

  14. Selection of antigenic and immunogenic mimics of hepatitis C virus using sera from patients.

    ID: 1274755

    Description: epitope description:KLRRSTNWG host organism:Homo sapiens

    Publication: 8666827;

  15. Breaking immune tolerance to the prion protein using prion protein peptides plus oligodeoxynucleotide-CpG in mice.

    ID: 1274771

    Description: epitope description:DWEDRYYRENMYRYPNQVYYRPVDQYSN antigen name:Major prion protein host organism:Mus musculus C57BL/6

    Publication: 15100253;

  16. Breaking immune tolerance to the prion protein using prion protein peptides plus oligodeoxynucleotide-CpG in mice.

    ID: 1274776

    Description: epitope description:NQVYYRPVDQYSNQNNFVHDCVNITIKQHT antigen name:Major prion protein host organism:Mus musculus C57BL/6

    Publication: 15100253;

  17. Mapping of a conformational epitope shared between E1 and E2 on the serum-derived human hepatitis C virus envelope.

    ID: 1274781

    Description: epitope description:SPLRRHYELPLIQ host organism:Mus musculus BALB/c antibody name:D32.10

    Publication: 12882983;

  18. Mapping of a conformational epitope shared between E1 and E2 on the serum-derived human hepatitis C virus envelope.

    ID: 1274784

    Description: epitope description:SQRSRHWHDVPK host organism:Mus musculus BALB/c antibody name:D32.10

    Publication: 12882983;

  19. Mapping of a conformational epitope shared between E1 and E2 on the serum-derived human hepatitis C virus envelope.

    ID: 1274788

    Description: epitope description:WHRTPSTLWGVI host organism:Mus musculus BALB/c antibody name:D32.10

    Publication: 12882983;

  20. Mapping of a conformational epitope shared between E1 and E2 on the serum-derived human hepatitis C virus envelope.

    ID: 1274796

    Description: epitope description:HLYHKNRNHIAY host organism:Mus musculus BALB/c antibody name:D32.10

    Publication: 12882983;

  21. Selective and efficient immunoprecipitation of the disease-associated form of the prion protein can be mediated by nonspecific interactions between mo...

    ID: 1274827

    Description: epitope description:HMAGAAAA antigen name:Major prion protein host organism:Mus musculus Biozzi antibody name:Pri-308

    Publication: 15140886;

  22. Selective and efficient immunoprecipitation of the disease-associated form of the prion protein can be mediated by nonspecific interactions between mo...

    ID: 1274828

    Description: epitope description:TQYERE antigen name:Major prion protein host organism:Mus musculus Biozzi antibody name:Pri-917

    Publication: 15140886;

  23. Localization of protective epitopes of the amino terminus of type 5 streptococcal M protein.

    ID: 1274833

    Description: epitope description:DLKTNNEGLK antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2422314;

  24. Localization of protective epitopes of the amino terminus of type 5 streptococcal M protein.

    ID: 1274834

    Description: epitope description:DLKTNNEGLK antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2422314;

  25. Epitope mapping of neutralizing botulinum neurotoxin A antibodies by phage display.

    ID: 1274837

    Description: epitope description:RGYMYLKGPRGSVMTTNIYLNSSLYRGTKFIIKKYASGNKDNIVRNNDRVYINVVVKNKEYRLATNASQAGVEKILSALEIPDVGNLSQVVVMKSKNDQGITNKCKMNLQDNNGNDIGFIGFHQFNNIAK...

    Publication: 11553596;

  26. Mapping of B-cell epitopes in the nucleocapsid protein of Puumala hantavirus.

    ID: 1274852

    Description: epitope description:SSLRYGNVLDVNAI antigen name:Puumala orthohantavirus protein host organism:Myodes glareolus antibody name:5E1

    Publication: 11952140;

  27. Mapping of B-cell epitopes in the nucleocapsid protein of Puumala hantavirus.

    ID: 1274858

    Description: epitope description:DDVNKNTLQARQQT antigen name:Puumala orthohantavirus protein host organism:Myodes glareolus antibody name:5B5

    Publication: 11952140;

  28. Mapping of B-cell epitopes in the nucleocapsid protein of Puumala hantavirus.

    ID: 1274863

    Description: epitope description:NKNTLQARQQTVSA antigen name:Puumala orthohantavirus protein host organism:Myodes glareolus antibody name:5B5

    Publication: 11952140;

  29. Mapping of B-cell epitopes in the nucleocapsid protein of Puumala hantavirus.

    ID: 1274865

    Description: epitope description:TKPTDPTGIEPDDH antigen name:Puumala orthohantavirus protein host organism:Myodes glareolus antibody name:5B5

    Publication: 11952140;

  30. Mapping of B-cell epitopes in the nucleocapsid protein of Puumala hantavirus.

    ID: 1274870

    Description: epitope description:IILKALYMLSTRGR antigen name:Puumala orthohantavirus protein host organism:Myodes glareolus antibody name:4E5

    Publication: 11952140;

  31. Mapping of B-cell epitopes in the nucleocapsid protein of Puumala hantavirus.

    ID: 1274878

    Description: epitope description:RNKIYFMQRQDVLD antigen name:Puumala orthohantavirus protein host organism:Myodes glareolus antibody name:5F4

    Publication: 11952140;

  32. Selective and efficient immunoprecipitation of the disease-associated form of the prion protein can be mediated by nonspecific interactions between mo...

    ID: 1274886

    Description: epitope description:RESQAYYQR antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:Bar-234

    Publication: 15140886;

  33. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274898

    Description: epitope description:DRGGRE antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  34. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274899

    Description: epitope description:RGGRED antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  35. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274904

    Description: epitope description:DILEQW antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  36. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274906

    Description: epitope description:LEQWVS antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  37. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274909

    Description: epitope description:WVSGRK antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  38. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274911

    Description: epitope description:SGRKKL antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  39. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274914

    Description: epitope description:KKLEEL antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  40. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274921

    Description: epitope description:RDLRKL antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  41. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274929

    Description: epitope description:KIKKLE antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  42. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274934

    Description: epitope description:EEDNPW antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  43. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274936

    Description: epitope description:DNPWLG antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  44. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274937

    Description: epitope description:NPWLGN antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  45. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274938

    Description: epitope description:PWLGNI antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  46. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274946

    Description: epitope description:IIGKKD antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  47. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274949

    Description: epitope description:KKDKDG antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  48. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274951

    Description: epitope description:DKDGEG antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  49. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274957

    Description: epitope description:APPAKK antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;

  50. Immunogenic domains of hepatitis delta virus antigen: peptide mapping of epitopes recognized by human and woodchuck antibodies.

    ID: 1274958

    Description: epitope description:PPAKKL antigen name:Large delta antigen host organism:Homo sapiens

    Publication: 1689390;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston