Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Successful adjuvant-free vaccination of BALB/c mice with mutated amyloid beta peptides.

    ID: 1643132

    Description: epitope description:DAEFRHDSGYEVHHQKLVFFAMDVGSNKGAIIGLMVGGVVIA host organism:Mus musculus BALB/c

    Publication: 18282292;

  2. Successful adjuvant-free vaccination of BALB/c mice with mutated amyloid beta peptides.

    ID: 1643133

    Description: epitope description:DAEFRHDSGYEVHHQKLVFFAMDVGSNKGAIIGLMVGGVVIA host organism:Mus musculus BALB/c

    Publication: 18282292;

  3. Successful adjuvant-free vaccination of BALB/c mice with mutated amyloid beta peptides.

    ID: 1643134

    Description: epitope description:DAEFRHDSGYEVHHQKLVFFAMDVGSNKGAIIGLMVGGVVIA host organism:Mus musculus BALB/c

    Publication: 18282292;

  4. Successful adjuvant-free vaccination of BALB/c mice with mutated amyloid beta peptides.

    ID: 1643135

    Description: epitope description:DAEFRHDSGYEVHHQKLVFFAMDVGSNKGAIIGLMVGGVVIA host organism:Mus musculus BALB/c

    Publication: 18282292;

  5. Successful adjuvant-free vaccination of BALB/c mice with mutated amyloid beta peptides.

    ID: 1643149

    Description: epitope description:DAEFRHDSGYEVHHQK antigen name:Amyloid beta A4 protein host organism:Mus musculus BALB/c

    Publication: 18282292;

  6. Successful adjuvant-free vaccination of BALB/c mice with mutated amyloid beta peptides.

    ID: 1643156

    Description: epitope description:VHHQKLVFFAEDVGSNK antigen name:Amyloid beta A4 protein host organism:Mus musculus BALB/c

    Publication: 18282292;

  7. Successful adjuvant-free vaccination of BALB/c mice with mutated amyloid beta peptides.

    ID: 1643165

    Description: epitope description:GAIIGLMVGGVVIA antigen name:Amyloid beta A4 protein host organism:Mus musculus BALB/c

    Publication: 18282292;

  8. Par j 1 and Par j 2, the major allergens from Parietaria judaica pollen, have similar immunoglobulin E epitopes.

    ID: 1643202

    Description: epitope description:SKGCCSGAKRLD antigen name:Other Parietaria judaica protein host organism:Homo sapiens

    Publication: 12680870;

  9. Par j 1 and Par j 2, the major allergens from Parietaria judaica pollen, have similar immunoglobulin E epitopes.

    ID: 1643213

    Description: epitope description:KLPPIDVNMDCK antigen name:Other Parietaria judaica protein host organism:Homo sapiens

    Publication: 12680870;

  10. Par j 1 and Par j 2, the major allergens from Parietaria judaica pollen, have similar immunoglobulin E epitopes.

    ID: 1643214

    Description: epitope description:DVNMDCKTVGVV antigen name:Par j 1 host organism:Homo sapiens

    Publication: 12680870;

  11. Par j 1 and Par j 2, the major allergens from Parietaria judaica pollen, have similar immunoglobulin E epitopes.

    ID: 1643223

    Description: epitope description:CLPFVQGKEK antigen name:Other Parietaria judaica protein host organism:Homo sapiens

    Publication: 12680870;

  12. Par j 1 and Par j 2, the major allergens from Parietaria judaica pollen, have similar immunoglobulin E epitopes.

    ID: 1643224

    Description: epitope description:PFVQGKEKEP antigen name:Other Parietaria judaica protein host organism:Homo sapiens

    Publication: 12680870;

  13. Par j 1 and Par j 2, the major allergens from Parietaria judaica pollen, have similar immunoglobulin E epitopes.

    ID: 1643227

    Description: epitope description:EKEPSKGCCS antigen name:Other Parietaria judaica protein host organism:Homo sapiens

    Publication: 12680870;

  14. Par j 1 and Par j 2, the major allergens from Parietaria judaica pollen, have similar immunoglobulin E epitopes.

    ID: 1643230

    Description: epitope description:GCCSGAKRLD antigen name:Other Parietaria judaica protein host organism:Homo sapiens

    Publication: 12680870;

  15. Par j 1 and Par j 2, the major allergens from Parietaria judaica pollen, have similar immunoglobulin E epitopes.

    ID: 1643238

    Description: epitope description:PQRVHACECI antigen name:Par j 1 host organism:Homo sapiens

    Publication: 12680870;

  16. Par j 1 and Par j 2, the major allergens from Parietaria judaica pollen, have similar immunoglobulin E epitopes.

    ID: 1643241

    Description: epitope description:EVPKHCGIVD antigen name:Other Parietaria judaica protein host organism:Homo sapiens

    Publication: 12680870;

  17. Par j 1 and Par j 2, the major allergens from Parietaria judaica pollen, have similar immunoglobulin E epitopes.

    ID: 1643253

    Description: epitope description:LERPQIRVPP antigen name:Other Parietaria judaica protein host organism:Homo sapiens

    Publication: 12680870;

  18. Par j 1 and Par j 2, the major allergens from Parietaria judaica pollen, have similar immunoglobulin E epitopes.

    ID: 1643267

    Description: epitope description:KLSEEVKTTEQK antigen name:Par j 2 host organism:Homo sapiens

    Publication: 12680870;

  19. Par j 1 and Par j 2, the major allergens from Parietaria judaica pollen, have similar immunoglobulin E epitopes.

    ID: 1643268

    Description: epitope description:VKTTEQKREACK antigen name:Par j 2 host organism:Homo sapiens

    Publication: 12680870;

  20. Antigenic characterization and cytolocalization of P35, the major Mycoplasma penetrans antigen.

    ID: 1627842

    Description: epitope description:KATPNDGYFWED antigen name:Lipoprotein p35 host organism:Macaca

    Publication: 10075417;

  21. Antigenic characterization and cytolocalization of P35, the major Mycoplasma penetrans antigen.

    ID: 1627843

    Description: epitope description:NDGYFWEDGTNG antigen name:Lipoprotein p35 host organism:Macaca

    Publication: 10075417;

  22. Immunological characterization of antibodies against synthetic peptides of glutamic acid decarboxylase.

    ID: 1630720

    Description: epitope description:SFGSEDGSGDSENPGTARAWC antigen name:Glutamate decarboxylase 2 host organism:Oryctolagus cuniculus

    Publication: 8814352;

  23. Structures of two major allergens, Bla g 4 and Per a 4, from cockroaches and their IgE binding epitopes.

    ID: 1630721

    Description: epitope description:R29, R31, K80, K85 antigen name:Bla g 4 host organism:Homo sapiens

    Publication: 19056737;

  24. Immunological characterization of antibodies against synthetic peptides of glutamic acid decarboxylase.

    ID: 1630722

    Description: epitope description:ATSSNAGADPNTTNLRPTTYDTWC antigen name:Glutamate decarboxylase 1 host organism:Oryctolagus cuniculus

    Publication: 8814352;

  25. Structures of two major allergens, Bla g 4 and Per a 4, from cockroaches and their IgE binding epitopes.

    ID: 1630724

    Description: epitope description:D16, D49, E80, Q105 antigen name:Other Periplaneta americana (American cockroach) protein host organism:Homo sapiens

    Publication: 19056737;

  26. Immunological characterization of antibodies against synthetic peptides of glutamic acid decarboxylase.

    ID: 1630725

    Description: epitope description:FFRMVISNPAATQSDIDFLIE antigen name:Glutamate decarboxylase 1 host organism:Oryctolagus cuniculus

    Publication: 8814352;

  27. Immunological characterization of antibodies against synthetic peptides of glutamic acid decarboxylase.

    ID: 1630737

    Description: epitope description:ATSSNAGADPNTTNLRPTTYDTWC antigen name:Glutamate decarboxylase 1 host organism:Oryctolagus cuniculus

    Publication: 8814352;

  28. Immunological characterization of antibodies against synthetic peptides of glutamic acid decarboxylase.

    ID: 1630772

    Description: epitope description:SFGSEDGSGDSENPGTARAWC antigen name:Glutamate decarboxylase 2 host organism:Oryctolagus cuniculus

    Publication: 8814352;

  29. Novel affinity tag system using structurally defined antibody-tag interaction: application to single-step protein purification.

    ID: 1630832

    Description: epitope description:PRGYPGQV antigen name:Proteinase-activated receptor 4 host organism:Mus musculus BALB/c antibody name:P20.1

    Publication: 18787202;

  30. Antigenic characterization and cytolocalization of P35, the major Mycoplasma penetrans antigen.

    ID: 1630850

    Description: epitope description:DTKTGTDRETTS antigen name:Lipoprotein p35 host organism:Homo sapiens

    Publication: 10075417;

  31. Antigenic characterization and cytolocalization of P35, the major Mycoplasma penetrans antigen.

    ID: 1630858

    Description: epitope description:CDLIPNLKLNNG antigen name:Lipoprotein p35 host organism:Homo sapiens

    Publication: 10075417;

  32. Antigenic characterization and cytolocalization of P35, the major Mycoplasma penetrans antigen.

    ID: 1630859

    Description: epitope description:PNLKLNNGTDYK antigen name:Lipoprotein p35 host organism:Homo sapiens

    Publication: 10075417;

  33. Antigenic characterization and cytolocalization of P35, the major Mycoplasma penetrans antigen.

    ID: 1630863

    Description: epitope description:TLAEADRTNAEK antigen name:Lipoprotein p35 host organism:Homo sapiens

    Publication: 10075417;

  34. Antigenic characterization and cytolocalization of P35, the major Mycoplasma penetrans antigen.

    ID: 1630870

    Description: epitope description:NDGYFWEDGTNG antigen name:Lipoprotein p35 host organism:Homo sapiens

    Publication: 10075417;

  35. Monoclonal antibody 76F distinguishes IA-2 from IA-2beta and overlaps an autoantibody epitope.

    ID: 1630872

    Description: epitope description:FEYQD antigen name:Receptor-type tyrosine-protein phosphatase-like N host organism:Mus musculus BALB/c antibody name:76F

    Publication: 16503116;

  36. Humoral immune responses of dengue fever patients using epitope-specific serotype-2 virus-like particle antigens.

    ID: 1630906

    Description: epitope description:G106 antigen name:Genome polyprotein host organism:Mus musculus antibody name:4A1B-9

    Publication: 19337372;

  37. Humoral immune responses of dengue fever patients using epitope-specific serotype-2 virus-like particle antigens.

    ID: 1630913

    Description: epitope description:G106, L107, P364 antigen name:Genome polyprotein host organism:Mus musculus antibody name:1B4C-2

    Publication: 19337372;

  38. Characterization of the serological response to phospholipase D protein of Chlamydophila pneumoniae in patients with acute coronary syndromes.

    ID: 1630941

    Description: epitope description:TIYYQKFKIPQILK antigen name:UniProt:Q7VQ43 host organism:Mus musculus ICR

    Publication: 19397877;

  39. Characterization of the serological response to phospholipase D protein of Chlamydophila pneumoniae in patients with acute coronary syndromes.

    ID: 1630952

    Description: epitope description:TIYYQKFKIPQILK antigen name:UniProt:Q7VQ43 host organism:Homo sapiens

    Publication: 19397877;

  40. Monoclonal antibody 76F distinguishes IA-2 from IA-2beta and overlaps an autoantibody epitope.

    ID: 1630961

    Description: epitope description:WQALCAYQAE antigen name:Receptor-type tyrosine-protein phosphatase-like N host organism:Mus musculus BALB/c antibody name:A9

    Publication: 16503116;

  41. Monoclonal antibody 76F distinguishes IA-2 from IA-2beta and overlaps an autoantibody epitope.

    ID: 1630962

    Description: epitope description:WQALCAYQAE antigen name:Receptor-type tyrosine-protein phosphatase-like N host organism:Mus musculus BALB/c antibody name:A9

    Publication: 16503116;

  42. Peptide specificity of high-titer anti-glutamic acid decarboxylase (GAD)65 autoantibodies.

    ID: 1631038

    Description: epitope description:GFWSFGSEDGSG antigen name:Glutamate decarboxylase 2 host organism:Homo sapiens

    Publication: 9698109;

  43. Peptide specificity of high-titer anti-glutamic acid decarboxylase (GAD)65 autoantibodies.

    ID: 1631044

    Description: epitope description:KLCALLYGDAEK antigen name:Glutamate decarboxylase 2 host organism:Homo sapiens

    Publication: 9698109;

  44. Peptide specificity of high-titer anti-glutamic acid decarboxylase (GAD)65 autoantibodies.

    ID: 1631052

    Description: epitope description:PCSCSKVDVNYA antigen name:Glutamate decarboxylase 2 host organism:Homo sapiens

    Publication: 9698109;

  45. Peptide specificity of high-titer anti-glutamic acid decarboxylase (GAD)65 autoantibodies.

    ID: 1631054

    Description: epitope description:AFDPLLAVADIC antigen name:Glutamate decarboxylase 2 host organism:Homo sapiens

    Publication: 9698109;

  46. Genetic differentiation of poly I:C from B:9-23 peptide induced experimental autoimmune diabetes.

    ID: 1631102

    Description: epitope description:SHLVEALYLVCGERG antigen name:Insulin-2 (UniProt:P01326) host organism:Mus musculus C57BL/6 antibody name:Insulin autoantibodies (I...

    Publication: 15120754;

  47. Peptide mimics selected from immune sera using phage display technology can replace native antigens in the diagnosis of Epstein-Barr virus infection.

    ID: 1631152

    Description: epitope description:FVNAFQNANFMRPRELFALA host organism:Oryctolagus cuniculus New Zealand White

    Publication: 19073711;

  48. Peptide mimics selected from immune sera using phage display technology can replace native antigens in the diagnosis of Epstein-Barr virus infection.

    ID: 1631154

    Description: epitope description:SANLNFFSPDFGLYTPNASA host organism:Oryctolagus cuniculus New Zealand White

    Publication: 19073711;

  49. Peptide mimics selected from immune sera using phage display technology can replace native antigens in the diagnosis of Epstein-Barr virus infection.

    ID: 1631157

    Description: epitope description:RLRGDYNVGPIRFGWPVAPN host organism:Oryctolagus cuniculus New Zealand White

    Publication: 19073711;

  50. Peptide mimics selected from immune sera using phage display technology can replace native antigens in the diagnosis of Epstein-Barr virus infection.

    ID: 1631162

    Description: epitope description:GVTDFDFKVFSSTFPKIFLS host organism:Oryctolagus cuniculus New Zealand White

    Publication: 19073711;

  51. A common epitope of beta-lactoglobulin and serum retinol-binding proteins: elucidation of its core sequence using synthetic peptides.

    ID: 1631255

    Description: epitope description:DTDY antigen name:Bos d 5 host organism:Mus musculus Swiss antibody name:B7B10

    Publication: 1373468;

  52. Identification of autoantibody epitopes of glutamic acid decarboxylase in stiff-man syndrome patients.

    ID: 1631857

    Description: epitope description:AMMIARFKMFPEVKEKGMAA antigen name:Glutamate decarboxylase 2 host organism:Homo sapiens

    Publication: 7506741;

  53. Identification of autoantibody epitopes of glutamic acid decarboxylase in stiff-man syndrome patients.

    ID: 1631861

    Description: epitope description:CSALLVREEGLMQN antigen name:Glutamate decarboxylase 2 host organism:Homo sapiens

    Publication: 7506741;

  54. Identification of autoantibody epitopes of glutamic acid decarboxylase in stiff-man syndrome patients.

    ID: 1631865

    Description: epitope description:RTLEDNEERMSRLSKVA antigen name:Glutamate decarboxylase 2 host organism:Homo sapiens

    Publication: 7506741;

  55. Peptide mimics selected from immune sera using phage display technology can replace native antigens in the diagnosis of Epstein-Barr virus infection.

    ID: 1632054

    Description: epitope description:GGWYSFDSPYLMSITEMRLR host organism:Homo sapiens

    Publication: 19073711;

  56. Treatment of NOD diabetes with a novel peptide of the hsp60 molecule induces Th2-type antibodies.

    ID: 1632139

    Description: epitope description:EGDEATGANIVKVALEA antigen name:60 kDa chaperonin 2 (UniProt:P9WPE7) host organism:Mus musculus NOD

    Publication: 9237795;

  57. Molecular characterization of chicken prion proteins by C-terminal-specific monoclonal antibodies.

    ID: 1632147

    Description: epitope description:SPVPQD antigen name:Major prion protein homolog host organism:Mus musculus BALB/c antibody name:mAb 14

    Publication: 19118905;

  58. Molecular characterization of chicken prion proteins by C-terminal-specific monoclonal antibodies.

    ID: 1632148

    Description: epitope description:ANQTEVEMEN antigen name:Major prion protein homolog host organism:Mus musculus BALB/c antibody name:mAb 26

    Publication: 19118905;

  59. Molecular characterization of chicken prion proteins by C-terminal-specific monoclonal antibodies.

    ID: 1632149

    Description: epitope description:AAANQT antigen name:Major prion protein homolog host organism:Mus musculus BALB/c antibody name:mAb G2

    Publication: 19118905;

  60. Molecular characterization of chicken prion proteins by C-terminal-specific monoclonal antibodies.

    ID: 1632388

    Description: epitope description:AAANQT antigen name:Major prion protein homolog host organism:Mus musculus BALB/c antibody name:mAb G2

    Publication: 19118905;

  61. Identification of epitopes on the human insulin receptor reacting with rabbit polyclonal antisera and mouse monoclonal antibodies.

    ID: 1632421

    Description: epitope description:PATVINGQFVERCWTH antigen name:Insulin receptor host organism:Oryctolagus cuniculus

    Publication: 1693619;

  62. Identification of epitopes on the human insulin receptor reacting with rabbit polyclonal antisera and mouse monoclonal antibodies.

    ID: 1632429

    Description: epitope description:KRQPDGPLGPLYASSNPEYLSASDVFPCS antigen name:Insulin receptor host organism:Oryctolagus cuniculus

    Publication: 1693619;

  63. Higher autoantibody levels and recognition of a linear NH2-terminal epitope in the autoantigen GAD65, distinguish stiff-man syndrome from insulin-depe...

    ID: 1632431

    Description: epitope description:TQSDIDFLIEEIERLGQDL antigen name:Glutamate decarboxylase 1 host organism:Oryctolagus cuniculus

    Publication: 7519242;

  64. Identification of biologically active peptides that inhibit binding of human CXCL8 to its receptors from a random phage-epitope library.

    ID: 1632437

    Description: epitope description:SFIWDF host organism:Mus musculus antibody name:anti-CXCR1 mAb 5A12

    Publication: 19118103;

  65. Identification of biologically active peptides that inhibit binding of human CXCL8 to its receptors from a random phage-epitope library.

    ID: 1632449

    Description: epitope description:ITMWDF host organism:Mus musculus antibody name:anti-CXCR1 mAb 5A12

    Publication: 19118103;

  66. Identification of biologically active peptides that inhibit binding of human CXCL8 to its receptors from a random phage-epitope library.

    ID: 1632450

    Description: epitope description:SDWWDF host organism:Mus musculus antibody name:anti-CXCR1 mAb 5A12

    Publication: 19118103;

  67. Identification of biologically active peptides that inhibit binding of human CXCL8 to its receptors from a random phage-epitope library.

    ID: 1632451

    Description: epitope description:SDWWDF host organism:Mus musculus antibody name:anti-CXCR1 mAb 5A12

    Publication: 19118103;

  68. Identification of biologically active peptides that inhibit binding of human CXCL8 to its receptors from a random phage-epitope library.

    ID: 1632453

    Description: epitope description:FWDDFW host organism:Mus musculus antibody name:anti-CXCR2 mAb 6C6

    Publication: 19118103;

  69. Identification of biologically active peptides that inhibit binding of human CXCL8 to its receptors from a random phage-epitope library.

    ID: 1632454

    Description: epitope description:LWDDFW host organism:Mus musculus antibody name:anti-CXCR2 mAb 6C6

    Publication: 19118103;

  70. Identification of biologically active peptides that inhibit binding of human CXCL8 to its receptors from a random phage-epitope library.

    ID: 1632455

    Description: epitope description:LWDDFW host organism:Mus musculus antibody name:anti-CXCR2 mAb 6C6

    Publication: 19118103;

  71. Higher autoantibody levels and recognition of a linear NH2-terminal epitope in the autoantigen GAD65, distinguish stiff-man syndrome from insulin-depe...

    ID: 1632469

    Description: epitope description:ARDLLPAKNGEEQTVQFLLE antigen name:Glutamate decarboxylase 1 host organism:Homo sapiens

    Publication: 7519242;

  72. Characterisation of an autoreactive conformational epitope on GAD65 recognised by the human monoclonal antibody b78 using a combination of phage displ...

    ID: 1632477

    Description: epitope description:EDYWLRS host organism:Homo sapiens antibody name:b78

    Publication: 16564157;

  73. Characterisation of an autoreactive conformational epitope on GAD65 recognised by the human monoclonal antibody b78 using a combination of phage displ...

    ID: 1632487

    Description: epitope description:RTRNQPN host organism:Homo sapiens antibody name:b78

    Publication: 16564157;

  74. Characterisation of an autoreactive conformational epitope on GAD65 recognised by the human monoclonal antibody b78 using a combination of phage displ...

    ID: 1632492

    Description: epitope description:YSYPANK host organism:Homo sapiens antibody name:b78

    Publication: 16564157;

  75. Characterisation of an autoreactive conformational epitope on GAD65 recognised by the human monoclonal antibody b78 using a combination of phage displ...

    ID: 1632495

    Description: epitope description:PWYAPFR host organism:Mus musculus antibody name:GAD6

    Publication: 16564157;

  76. Characterisation of an autoreactive conformational epitope on GAD65 recognised by the human monoclonal antibody b78 using a combination of phage displ...

    ID: 1632506

    Description: epitope description:PNAPDAS host organism:Mus musculus antibody name:GAD6

    Publication: 16564157;

  77. Characterisation of an autoreactive conformational epitope on GAD65 recognised by the human monoclonal antibody b78 using a combination of phage displ...

    ID: 1632514

    Description: epitope description:DF antigen name:Glutamate decarboxylase 2 host organism:Homo sapiens antibody name:b78

    Publication: 16564157;

  78. Analysis of eluted peptides from type 1 diabetes-susceptible HLA class II molecules identified novel islet protein, heparin/heparan sulfate-interactin...

    ID: 1633148

    Description: epitope description:AKSKNHTTHN antigen name:60S ribosomal protein L29 host organism:Cavia porcellus Hartley

    Publication: 15721314;

  79. Identification of a novel type 1 diabetes-specific epitope by screening phage libraries with sera from pre-diabetic patients.

    ID: 1633945

    Description: epitope description:NRVAPNVRQ host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9171283;

  80. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634042

    Description: epitope description:WGPSSDPAWERNDPT antigen name:Diacylglycerol acyltransferase/mycolyltransferase Ag85B host organism:Homo sapiens

    Publication: 19065269;

  81. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634044

    Description: epitope description:VLLESMKMEIPVLAE antigen name:Biotinylated protein TB7.3 host organism:Homo sapiens

    Publication: 19065269;

  82. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634046

    Description: epitope description:EGWGKSPGFGTTVDF antigen name:Phosphate-binding protein PstS 1 host organism:Homo sapiens

    Publication: 19065269;

  83. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634064

    Description: epitope description:MTLLELSDFVKKFEE antigen name:50S ribosomal protein L7/L12 host organism:Homo sapiens

    Publication: 19065269;

  84. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634065

    Description: epitope description:SVPANVSRRAKVDVL antigen name:Universal stress protein Rv1636 host organism:Homo sapiens

    Publication: 19065269;

  85. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634079

    Description: epitope description:TLQAFLHWAITDGNK antigen name:Phosphate-binding protein PstS 1 host organism:Homo sapiens

    Publication: 19065269;

  86. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634086

    Description: epitope description:TIEQLLTIPLAKELA antigen name:Malate synthase G host organism:Homo sapiens

    Publication: 19065269;

  87. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634088

    Description: epitope description:SPHPLLTHAVEQTGR antigen name:Polyketide synthase (UniProt:I6Y231) host organism:Homo sapiens

    Publication: 19065269;

  88. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634090

    Description: epitope description:SKVSTVKDLLPLLEK antigen name:60 kDa chaperonin 2 (UniProt:P9WPE7) host organism:Homo sapiens

    Publication: 19065269;

  89. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634091

    Description: epitope description:LFSRVEDVLGLPQNT antigen name:Malate synthase G host organism:Homo sapiens

    Publication: 19065269;

  90. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634092

    Description: epitope description:MWELYLAYSEAGFRS antigen name:Cyclopropane-fatty-acyl-phospholipid synthase (UniProt:Q7D9T1) host organism:Homo sapiens

    Publication: 19065269;

  91. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634095

    Description: epitope description:YDREKLQERLAKLAG antigen name:60 kDa chaperonin 2 (UniProt:P9WPE7) host organism:Homo sapiens

    Publication: 19065269;

  92. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634098

    Description: epitope description:ANRAVKPTGSAAIGL antigen name:Diacylglycerol acyltransferase/mycolyltransferase Ag85B host organism:Homo sapiens

    Publication: 19065269;

  93. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634104

    Description: epitope description:LGWKVSDLKSSTAVI antigen name:Immunogenic protein MPT63 host organism:Homo sapiens

    Publication: 19065269;

  94. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634107

    Description: epitope description:QGQWRGAAGTAAQAA antigen name:ESAT-6-like protein EsxB host organism:Homo sapiens

    Publication: 19065269;

  95. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634111

    Description: epitope description:QVGSQFGPYQLLRLL antigen name:Serine/threonine-protein kinase PknD host organism:Homo sapiens

    Publication: 19065269;

  96. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634114

    Description: epitope description:DVGSLNGTYVNREPV antigen name:Glycogen accumulation regulator GarA host organism:Homo sapiens

    Publication: 19065269;

  97. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634115

    Description: epitope description:SEFDVILEAAGDKKI antigen name:50S ribosomal protein L7/L12 host organism:Homo sapiens

    Publication: 19065269;

  98. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634118

    Description: epitope description:EAEHQAIVRDVLAAG antigen name:ESAT-6-like protein EsxN host organism:Homo sapiens

    Publication: 19065269;

  99. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634119

    Description: epitope description:YIGISFLDQASQRGL antigen name:Phosphate-binding protein PstS 1 host organism:Homo sapiens

    Publication: 19065269;

  100. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634129

    Description: epitope description:CVAYIGISFLDQASQ antigen name:Phosphate-binding protein PstS 1 host organism:Homo sapiens

    Publication: 19065269;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston