Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "
  1. Analysis of neutralizing epitopes on foot-and-mouth disease virus.

    ID: 1482056

    Description: epitope description:LRGDLQVLAQKVARTL antigen name:Polyprotein host organism:Oryctolagus cuniculus antibody name:anti-peptide A

    Publication: 2835507;
  2. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475076

    Description: epitope description:IANTTSFNGKQLLSGNFINQEFQIGASSNQ antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;
  3. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475077

    Description: epitope description:IANTTSFNGKQLLSGNFINQEFQIGASSNQ antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;
  4. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475089

    Description: epitope description:ASSNQTVKATIGATQSSKIGLTRFETGGRI antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;
  5. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475097

    Description: epitope description:TGGRISSSGEVQFTLKNYNGIDDFQFQKVV antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;
  6. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475113

    Description: epitope description:FQKVVISTSVGTGLGALADEINKNADKTGV antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;
  7. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475115

    Description: epitope description:FQKVVISTSVGTGLGALADEINKNADKTGV antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;
  8. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475126

    Description: epitope description:DDFAINGVKIGKVDYKDGDANGALVAAINS antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;
  9. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475128

    Description: epitope description:DDFAINGVKIGKVDYKDGDANGALVAAINS antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;
  10. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475129

    Description: epitope description:DDFAINGVKIGKVDYKDGDANGALVAAINS antigen name:Flagellin A host organism:Oryctolagus cuniculus New Zealand White

    Publication: 17704944;
  11. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475135

    Description: epitope description:DDFAINGVKIGKVDYKDGDANGALVAAINS antigen name:Flagellin A host organism:Oryctolagus cuniculus New Zealand White

    Publication: 17704944;
  12. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475140

    Description: epitope description:AAINSVKDTTGVEASIDANGQLLLTSREGR antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;
  13. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475157

    Description: epitope description:NYGRLSLVKNDGKDILISGSNLSSAGFGAT antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;
  14. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475162

    Description: epitope description:NYGRLSLVKNDGKDILISGSNLSSAGFGAT antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;
  15. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475170

    Description: epitope description:GFGATQFISQASVSLRESKGQIDANIADAM antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;
  16. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475175

    Description: epitope description:GFGATQFISQASVSLRESKGQIDANIADAM antigen name:Flagellin A host organism:Oryctolagus cuniculus New Zealand White

    Publication: 17704944;
  17. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475177

    Description: epitope description:IADAMGFGSANKGVVLGGYSSVSAYMSSAG antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;
  18. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475181

    Description: epitope description:IADAMGFGSANKGVVLGGYSSVSAYMSSAG antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;
  19. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475183

    Description: epitope description:IADAMGFGSANKGVVLGGYSSVSAYMSSAG antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;
  20. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475185

    Description: epitope description:IADAMGFGSANKGVVLGGYSSVSAYMSSAG antigen name:Flagellin A host organism:Oryctolagus cuniculus New Zealand White

    Publication: 17704944;

Displaying 20 of 1,510,353 results for " "