Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634136

    Description: epitope description:EKVAKEAADEAKAKL antigen name:50S ribosomal protein L7/L12 host organism:Homo sapiens

    Publication: 19065269;

  2. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634137

    Description: epitope description:PLDTPPAPAPPPFRL antigen name:PPE family protein PPE55 host organism:Homo sapiens

    Publication: 19065269;

  3. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634160

    Description: epitope description:AQAQHLTMANIVTSA antigen name:Phosphate-binding protein PstS 3 host organism:Homo sapiens

    Publication: 19065269;

  4. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634168

    Description: epitope description:LTTYILLPSQDLPLL antigen name:Uncharacterized PPE family protein PPE42 host organism:Homo sapiens

    Publication: 19065269;

  5. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634171

    Description: epitope description:SAFAAKAGLMRHTIG antigen name:ESAT-6-like protein EsxG host organism:Homo sapiens

    Publication: 19065269;

  6. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634172

    Description: epitope description:SAERCGSPAWDLPTV antigen name:Phosphate-binding protein PstS 2 host organism:Homo sapiens

    Publication: 19065269;

  7. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634190

    Description: epitope description:KTINLCAPDDPICTG antigen name:Probable cutinase Rv1984c host organism:Homo sapiens

    Publication: 19065269;

  8. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634194

    Description: epitope description:IWKLIKDMLILPYLD antigen name:Isocitrate dehydrogenase [NADP] host organism:Homo sapiens

    Publication: 19065269;

  9. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634196

    Description: epitope description:DRFADFPALPLDPSA antigen name:Probable serine protease PepA (Serine proteinase) (MTB32A) host organism:Homo sapiens

    Publication: 19065269;

  10. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634197

    Description: epitope description:VGNVGLSTIAGRLLG antigen name:Universal stress protein Rv1636 host organism:Homo sapiens

    Publication: 19065269;

  11. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634199

    Description: epitope description:VHNVAALPGAAYCEM antigen name:Polyketide synthase (UniProt:I6Y231) host organism:Homo sapiens

    Publication: 19065269;

  12. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634201

    Description: epitope description:LAALPDFLGGFAGLP antigen name:ESX-1 secretion-associated protein EspE host organism:Homo sapiens

    Publication: 19065269;

  13. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634202

    Description: epitope description:TVIAATAGRNHLKNV antigen name:PGL/p-HBAD biosynthesis glycosyltransferase Rv2958c host organism:Homo sapiens

    Publication: 19065269;

  14. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634218

    Description: epitope description:EPGVPGRSVSRWGGF antigen name:Polyketide synthase (UniProt:I6Y231) host organism:Homo sapiens

    Publication: 19065269;

  15. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634227

    Description: epitope description:SQVGTAVKAFLQSTI antigen name:Phosphate-binding protein PstS 3 host organism:Homo sapiens

    Publication: 19065269;

  16. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634228

    Description: epitope description:VGWANMGLGNIGFGN antigen name:PPE family protein PPE55 host organism:Homo sapiens

    Publication: 19065269;

  17. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634237

    Description: epitope description:SNAVDTPDMLASTLT antigen name:Polyketide synthase (UniProt:I6Y231) host organism:Homo sapiens

    Publication: 19065269;

  18. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634240

    Description: epitope description:RSVSRWGGFLDDVAG antigen name:Polyketide synthase (UniProt:I6Y231) host organism:Homo sapiens

    Publication: 19065269;

  19. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634241

    Description: epitope description:SDALRQTARQLATWV antigen name:Polyketide synthase (UniProt:I6Y231) host organism:Homo sapiens

    Publication: 19065269;

  20. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634247

    Description: epitope description:ISIPNNPLALLASAS antigen name:PPE family protein PPE55 host organism:Homo sapiens

    Publication: 19065269;

  21. Pattern recognition in pulmonary tuberculosis defined by high content peptide microarray chip analysis representing 61 proteins from M. tuberculosis.

    ID: 1634248

    Description: epitope description:DELIDRDWSPKVFGS antigen name:Polyketide synthase (UniProt:I6Y231) host organism:Homo sapiens

    Publication: 19065269;

  22. Determination of the mimic epitope of the M-like protein adhesin in swine Streptococcus equi subsp. zooepidemicus.

    ID: 1619958

    Description: epitope description:SSLSRGKPSPRP host organism:Mus musculus BALB/c antibody name:2C8

    Publication: 18840263;

  23. Determination of the mimic epitope of the M-like protein adhesin in swine Streptococcus equi subsp. zooepidemicus.

    ID: 1619963

    Description: epitope description:TWLTPSFPFYLG host organism:Mus musculus BALB/c antibody name:2C8

    Publication: 18840263;

  24. Determination of the mimic epitope of the M-like protein adhesin in swine Streptococcus equi subsp. zooepidemicus.

    ID: 1619965

    Description: epitope description:TPLDRGTWLFTK host organism:Mus musculus BALB/c antibody name:2C8

    Publication: 18840263;

  25. Determination of the mimic epitope of the M-like protein adhesin in swine Streptococcus equi subsp. zooepidemicus.

    ID: 1619968

    Description: epitope description:NTFNEFWPSNSW host organism:Mus musculus BALB/c antibody name:2C8

    Publication: 18840263;

  26. Linear B-cell epitope mapping using enzyme-linked immunosorbent assay for libraries of overlapping synthetic peptides.

    ID: 1619977

    Description: epitope description:AGSGIVGSGSY antigen name:Virulence associated protein VapA host organism:Equus caballus

    Publication: 19377942;

  27. Linear B-cell epitope mapping using enzyme-linked immunosorbent assay for libraries of overlapping synthetic peptides.

    ID: 1619982

    Description: epitope description:TSLNLQKDEPN antigen name:Virulence associated protein VapA host organism:Equus caballus

    Publication: 19377942;

  28. Linear B-cell epitope mapping using enzyme-linked immunosorbent assay for libraries of overlapping synthetic peptides.

    ID: 1619983

    Description: epitope description:NLQKDEPNGRA antigen name:Virulence associated protein VapA host organism:Equus caballus

    Publication: 19377942;

  29. Linear B-cell epitope mapping using enzyme-linked immunosorbent assay for libraries of overlapping synthetic peptides.

    ID: 1619987

    Description: epitope description:DTAGQEQQYDV antigen name:Virulence associated protein VapA host organism:Equus caballus

    Publication: 19377942;

  30. Linear B-cell epitope mapping using enzyme-linked immunosorbent assay for libraries of overlapping synthetic peptides.

    ID: 1619995

    Description: epitope description:HVFGPEGKVFD antigen name:Virulence associated protein VapA host organism:Equus caballus

    Publication: 19377942;

  31. Linear B-cell epitope mapping using enzyme-linked immunosorbent assay for libraries of overlapping synthetic peptides.

    ID: 1620005

    Description: epitope description:TNDLQRLYKDT antigen name:Virulence associated protein VapA host organism:Equus caballus

    Publication: 19377942;

  32. Linear B-cell epitope mapping using enzyme-linked immunosorbent assay for libraries of overlapping synthetic peptides.

    ID: 1620006

    Description: epitope description:LQRLYKDTVSF antigen name:Virulence associated protein VapA host organism:Equus caballus

    Publication: 19377942;

  33. Linear B-cell epitope mapping using enzyme-linked immunosorbent assay for libraries of overlapping synthetic peptides.

    ID: 1620009

    Description: epitope description:SFQYNAVGPYL antigen name:Virulence associated protein VapA host organism:Equus caballus

    Publication: 19377942;

  34. Linear B-cell epitope mapping using enzyme-linked immunosorbent assay for libraries of overlapping synthetic peptides.

    ID: 1620010

    Description: epitope description:YNAVGPYLNIN antigen name:Virulence associated protein VapA host organism:Equus caballus

    Publication: 19377942;

  35. Linear B-cell epitope mapping using enzyme-linked immunosorbent assay for libraries of overlapping synthetic peptides.

    ID: 1620017

    Description: epitope description:HIQSGGVSTVV antigen name:Virulence associated protein VapA host organism:Equus caballus

    Publication: 19377942;

  36. Induction of immune responses to functional determinants of a cell surface streptococcal antigen.

    ID: 1620040

    Description: epitope description:DAYGIKSNVVRVTTPGKPND antigen name:UniProt:I6TX52 host organism:Mus musculus BALB/c

    Publication: 8666436;

  37. Induction of immune responses to functional determinants of a cell surface streptococcal antigen.

    ID: 1620042

    Description: epitope description:ETEKPLKPAPVAPNYEKEPT antigen name:UniProt:I6TX52 host organism:Mus musculus BALB/c

    Publication: 8666436;

  38. Induction of immune responses to functional determinants of a cell surface streptococcal antigen.

    ID: 1620045

    Description: epitope description:TEKPLEPAPVEPSYEAEP antigen name:UniProt:I6TX52 host organism:Mus musculus BALB/c

    Publication: 8666436;

  39. Induction of immune responses to functional determinants of a cell surface streptococcal antigen.

    ID: 1620059

    Description: epitope description:FQLKTADLPAGRDETTSFVL antigen name:UniProt:I6TX52 host organism:Mus musculus SJL

    Publication: 8666436;

  40. Induction of immune responses to functional determinants of a cell surface streptococcal antigen.

    ID: 1620094

    Description: epitope description:TLVAKQSVVKFQLKTADLPA antigen name:UniProt:I6TX52 host organism:Mus musculus BALB/c

    Publication: 8666436;

  41. PreS1 epitope recognition in newborns after vaccination with the third-generation Sci-B-Vac vaccine and their relation to the antibody response to hep...

    ID: 1620117

    Description: epitope description:PAFGANSNNPDWDFNP antigen name:Large envelope protein host organism:Homo sapiens

    Publication: 19154574;

  42. Identification of a virus-specific and conserved B-cell epitope on NS1 protein of Japanese encephalitis virus.

    ID: 1620124

    Description: epitope description:EHRAW antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1H6

    Publication: 19185592;

  43. PreS1 epitope recognition in newborns after vaccination with the third-generation Sci-B-Vac vaccine and their relation to the antibody response to hep...

    ID: 1620142

    Description: epitope description:PASTNRQSGRQPTPISPPLRDSHP antigen name:Large envelope protein host organism:Homo sapiens

    Publication: 19154574;

  44. Vaccination of BALB/c mice with Escherichia coli-expressed vaccinia virus proteins A27L, B5R, and D8L protects mice from lethal vaccinia virus challen...

    ID: 1620178

    Description: epitope description:DLAIPATEFFSTKADKKPEA antigen name:Protein A27 host organism:Mus musculus BALB/c

    Publication: 18199639;

  45. Vaccination of BALB/c mice with Escherichia coli-expressed vaccinia virus proteins A27L, B5R, and D8L protects mice from lethal vaccinia virus challen...

    ID: 1620183

    Description: epitope description:VTTKFEQIEKCCKRNDEVLF antigen name:Protein A27 host organism:Mus musculus BALB/c

    Publication: 18199639;

  46. Vaccination of BALB/c mice with Escherichia coli-expressed vaccinia virus proteins A27L, B5R, and D8L protects mice from lethal vaccinia virus challen...

    ID: 1620194

    Description: epitope description:PCKKMCTVSDYISELYNKPL antigen name:Plaque-size/host range protein host organism:Mus musculus BALB/c

    Publication: 18199639;

  47. Vaccination of BALB/c mice with Escherichia coli-expressed vaccinia virus proteins A27L, B5R, and D8L protects mice from lethal vaccinia virus challen...

    ID: 1620210

    Description: epitope description:NEEFDPVDDGPDDETDLSKL antigen name:Plaque-size/host range protein host organism:Mus musculus BALB/c

    Publication: 18199639;

  48. Vaccination of BALB/c mice with Escherichia coli-expressed vaccinia virus proteins A27L, B5R, and D8L protects mice from lethal vaccinia virus challen...

    ID: 1620215

    Description: epitope description:CSCDKNNDQYKFHKLLP antigen name:Plaque-size/host range protein host organism:Mus musculus BALB/c

    Publication: 18199639;

  49. Vaccination of BALB/c mice with Escherichia coli-expressed vaccinia virus proteins A27L, B5R, and D8L protects mice from lethal vaccinia virus challen...

    ID: 1620216

    Description: epitope description:MPQQLSPINIETKKAISNAR antigen name:Cell surface-binding protein host organism:Mus musculus BALB/c

    Publication: 18199639;

  50. Vaccination of BALB/c mice with Escherichia coli-expressed vaccinia virus proteins A27L, B5R, and D8L protects mice from lethal vaccinia virus challen...

    ID: 1620219

    Description: epitope description:SKPTTIQNTGKLVRINFKGG antigen name:Cell surface-binding protein host organism:Mus musculus BALB/c

    Publication: 18199639;

  51. Vaccination of BALB/c mice with Escherichia coli-expressed vaccinia virus proteins A27L, B5R, and D8L protects mice from lethal vaccinia virus challen...

    ID: 1620223

    Description: epitope description:GKEDDYGSNHLIDVYKYSGE antigen name:Cell surface-binding protein host organism:Mus musculus BALB/c

    Publication: 18199639;

  52. Vaccination of BALB/c mice with Escherichia coli-expressed vaccinia virus proteins A27L, B5R, and D8L protects mice from lethal vaccinia virus challen...

    ID: 1620225

    Description: epitope description:INLVHWNKKKYSSYEEAKKH antigen name:Cell surface-binding protein host organism:Mus musculus BALB/c

    Publication: 18199639;

  53. Vaccination of BALB/c mice with Escherichia coli-expressed vaccinia virus proteins A27L, B5R, and D8L protects mice from lethal vaccinia virus challen...

    ID: 1620230

    Description: epitope description:DSVFYLDNLLPSTLDYFTYL antigen name:Cell surface-binding protein host organism:Mus musculus BALB/c

    Publication: 18199639;

  54. Vaccination of BALB/c mice with Escherichia coli-expressed vaccinia virus proteins A27L, B5R, and D8L protects mice from lethal vaccinia virus challen...

    ID: 1620234

    Description: epitope description:TLLSSSNHDGKPYYITENYR antigen name:Cell surface-binding protein host organism:Mus musculus BALB/c

    Publication: 18199639;

  55. Vaccination of BALB/c mice with Escherichia coli-expressed vaccinia virus proteins A27L, B5R, and D8L protects mice from lethal vaccinia virus challen...

    ID: 1620237

    Description: epitope description:VYYSGEIIRAATTSPARENY antigen name:Cell surface-binding protein host organism:Mus musculus BALB/c

    Publication: 18199639;

  56. Vaccination of BALB/c mice with Escherichia coli-expressed vaccinia virus proteins A27L, B5R, and D8L protects mice from lethal vaccinia virus challen...

    ID: 1620243

    Description: epitope description:LFLMSRRYSREKQN antigen name:Cell surface-binding protein host organism:Mus musculus BALB/c

    Publication: 18199639;

  57. Dendritic cell-mediated-immunization with xenogenic PrP and adenoviral vectors breaks tolerance and prolongs mice survival against experimental scrapi...

    ID: 1620253

    Description: epitope description:KKRPKPGGWNTGGSRYPGQGSPGGNRYPP antigen name:Major prion protein host organism:Mus musculus C57BL/6

    Publication: 19295917;

  58. Dendritic cell-mediated-immunization with xenogenic PrP and adenoviral vectors breaks tolerance and prolongs mice survival against experimental scrapi...

    ID: 1620421

    Description: epitope description:PGQGSPGGNRYPPQGGTWGQPHGGGWGQP antigen name:Major prion protein host organism:Mus musculus C57BL/6

    Publication: 19295917;

  59. Dendritic cell-mediated-immunization with xenogenic PrP and adenoviral vectors breaks tolerance and prolongs mice survival against experimental scrapi...

    ID: 1620437

    Description: epitope description:WNKPSKPKTNLKHVAGAAAAGAVVGGLGGY antigen name:Major prion protein host organism:Mus musculus C57BL/6

    Publication: 19295917;

  60. Dendritic cell-mediated-immunization with xenogenic PrP and adenoviral vectors breaks tolerance and prolongs mice survival against experimental scrapi...

    ID: 1620469

    Description: epitope description:NFVHDCVNITIKQHTVT antigen name:Major prion protein host organism:Mus musculus C57BL/6

    Publication: 19295917;

  61. Dendritic cell-mediated-immunization with xenogenic PrP and adenoviral vectors breaks tolerance and prolongs mice survival against experimental scrapi...

    ID: 1620473

    Description: epitope description:KGENFTETDVKMMERVVEQMCVTQYQK antigen name:Major prion protein host organism:Mus musculus C57BL/6

    Publication: 19295917;

  62. Dendritic cell-mediated-immunization with xenogenic PrP and adenoviral vectors breaks tolerance and prolongs mice survival against experimental scrapi...

    ID: 1620481

    Description: epitope description:MCVTQYQKESQAYYDGRRSSS antigen name:Major prion protein host organism:Mus musculus C57BL/6

    Publication: 19295917;

  63. Induction of immune responses to functional determinants of a cell surface streptococcal antigen.

    ID: 1620523

    Description: epitope description:PTVHFHYFKLAVQPQVNKEI antigen name:UniProt:I6TX52 host organism:Mus musculus DBA

    Publication: 8666436;

  64. An antibody to the aggregated synthetic prion protein peptide (PrP106-126) selectively recognizes disease-associated prion protein (PrP) from human br...

    ID: 1620694

    Description: epitope description:KTNMKHMAGAAAAGAVVGGLG antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:P1:1

    Publication: 18507665;

  65. Epitope mapping using randomly generated peptide libraries.

    ID: 1620737

    Description: epitope description:THEDFRYDDVFEGN host organism:Mus musculus BALB/c

    Publication: 19377949;

  66. On a mouse monoclonal antibody that neutralizes all four dengue virus serotypes.

    ID: 1620811

    Description: epitope description:VQYEGDGSPCKI antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:9F12

    Publication: 19264660;

  67. On a mouse monoclonal antibody that neutralizes all four dengue virus serotypes.

    ID: 1620812

    Description: epitope description:VQYEGDGSPCKI antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:9F12

    Publication: 19264660;

  68. On a mouse monoclonal antibody that neutralizes all four dengue virus serotypes.

    ID: 1620818

    Description: epitope description:VQYEGDGSPCKI antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:9F12

    Publication: 19264660;

  69. On a mouse monoclonal antibody that neutralizes all four dengue virus serotypes.

    ID: 1620822

    Description: epitope description:VKEIAETQHG antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:9F12

    Publication: 19264660;

  70. On a mouse monoclonal antibody that neutralizes all four dengue virus serotypes.

    ID: 1620825

    Description: epitope description:VKEIAETQHG antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:9F12

    Publication: 19264660;

  71. On a mouse monoclonal antibody that neutralizes all four dengue virus serotypes.

    ID: 1620826

    Description: epitope description:VKEIAETQHG antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:9F12

    Publication: 19264660;

  72. Distinct antigenic features of linear epitopes at the N-terminus and C-terminus of 65 kDa glutamic acid decarboxylase (GAD65): implications for autoan...

    ID: 1620838

    Description: epitope description:MASPGSGFWSFGSEDGSGDS antigen name:Glutamate decarboxylase 2 host organism:Homo sapiens

    Publication: 12296864;

  73. Distinct antigenic features of linear epitopes at the N-terminus and C-terminus of 65 kDa glutamic acid decarboxylase (GAD65): implications for autoan...

    ID: 1620847

    Description: epitope description:DFLIEEIERLGQDL antigen name:Glutamate decarboxylase 2 host organism:Mus musculus BALB/c antibody name:C-MoAb

    Publication: 12296864;

  74. Distinct antigenic features of linear epitopes at the N-terminus and C-terminus of 65 kDa glutamic acid decarboxylase (GAD65): implications for autoan...

    ID: 1620851

    Description: epitope description:PGSGFWSFGSEDGS antigen name:Glutamate decarboxylase 2 host organism:Mus musculus NOD antibody name:N-MoAb

    Publication: 12296864;

  75. Distinct antigenic features of linear epitopes at the N-terminus and C-terminus of 65 kDa glutamic acid decarboxylase (GAD65): implications for autoan...

    ID: 1620852

    Description: epitope description:PGSGFWSFGSEDGS antigen name:Glutamate decarboxylase 2 host organism:Mus musculus NOD antibody name:N-MoAb

    Publication: 12296864;

  76. Distinct antigenic features of linear epitopes at the N-terminus and C-terminus of 65 kDa glutamic acid decarboxylase (GAD65): implications for autoan...

    ID: 1620857

    Description: epitope description:PGSGFWSFGSEDGS antigen name:Glutamate decarboxylase 2 host organism:Mus musculus NOD antibody name:N-MoAb

    Publication: 12296864;

  77. Distinct antigenic features of linear epitopes at the N-terminus and C-terminus of 65 kDa glutamic acid decarboxylase (GAD65): implications for autoan...

    ID: 1620862

    Description: epitope description:DFLIEEIERLGQDL antigen name:Glutamate decarboxylase 2 host organism:Mus musculus BALB/c antibody name:C-MoAb

    Publication: 12296864;

  78. Distinct antigenic features of linear epitopes at the N-terminus and C-terminus of 65 kDa glutamic acid decarboxylase (GAD65): implications for autoan...

    ID: 1620864

    Description: epitope description:DFLIEEIERLGQDL antigen name:Glutamate decarboxylase 2 host organism:Mus musculus BALB/c antibody name:C-MoAb

    Publication: 12296864;

  79. Distinct antigenic features of linear epitopes at the N-terminus and C-terminus of 65 kDa glutamic acid decarboxylase (GAD65): implications for autoan...

    ID: 1620865

    Description: epitope description:DFLIEEIERLGQDL antigen name:Glutamate decarboxylase 2 host organism:Mus musculus BALB/c antibody name:C-MoAb

    Publication: 12296864;

  80. Distinct antigenic features of linear epitopes at the N-terminus and C-terminus of 65 kDa glutamic acid decarboxylase (GAD65): implications for autoan...

    ID: 1620869

    Description: epitope description:DFLIEEIERLGQDL antigen name:Glutamate decarboxylase 2 host organism:Oryctolagus cuniculus New Zealand White antibody name:C-pc

    Publication: 12296864;

  81. Distinct antigenic features of linear epitopes at the N-terminus and C-terminus of 65 kDa glutamic acid decarboxylase (GAD65): implications for autoan...

    ID: 1620871

    Description: epitope description:DFLIEEIERLGQDL antigen name:Glutamate decarboxylase 2 host organism:Oryctolagus cuniculus New Zealand White antibody name:C-pc

    Publication: 12296864;

  82. Distinct antigenic features of linear epitopes at the N-terminus and C-terminus of 65 kDa glutamic acid decarboxylase (GAD65): implications for autoan...

    ID: 1620872

    Description: epitope description:DFLIEEIERLGQDL antigen name:Glutamate decarboxylase 2 host organism:Oryctolagus cuniculus New Zealand White antibody name:C-pc

    Publication: 12296864;

  83. Antibody and T-cell recognition of alpha-bungarotoxin and its synthetic loop-peptides.

    ID: 1620881

    Description: epitope description:CKMWADAFTSSRGKVVEC antigen name:UniProt:B2V3U8 host organism:Mus musculus ICR

    Publication: 7565818;

  84. Antibody and T-cell recognition of alpha-bungarotoxin and its synthetic loop-peptides.

    ID: 1620985

    Description: epitope description:CHTTATIPSSAVTC antigen name:Alpha-bungarotoxin isoform A31 host organism:Mus musculus SJL

    Publication: 7565818;

  85. Antibody and T-cell recognition of alpha-bungarotoxin and its synthetic loop-peptides.

    ID: 1620989

    Description: epitope description:CKMWADAFTSSRGKVVEC antigen name:UniProt:B2V3U8 host organism:Mus musculus SJL

    Publication: 7565818;

  86. Antibody and T-cell recognition of alpha-bungarotoxin and its synthetic loop-peptides.

    ID: 1620990

    Description: epitope description:CKMWADAFTSSRGKVVEC antigen name:UniProt:B2V3U8 host organism:Mus musculus SJL

    Publication: 7565818;

  87. Broad cross-protection against H5N1 avian influenza virus infection by means of monoclonal antibodies that map to conserved viral epitopes.

    ID: 1621146

    Description: epitope description:R205 antigen name:Hemagglutinin host organism:Mus musculus BALB/c

    Publication: 19032063;

  88. Broad cross-protection against H5N1 avian influenza virus infection by means of monoclonal antibodies that map to conserved viral epitopes.

    ID: 1621148

    Description: epitope description:R205 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:20A11, 16F13, 13D4, 16G3, 14E4, 20H2, 16A4, 4D1, 2...

    Publication: 19032063;

  89. Identification of measles virus epitopes using an ultra-fast method of panning phage-displayed random peptide libraries.

    ID: 1621360

    Description: epitope description:HEQPHWLLWQPP host organism:Homo sapiens antibody name:2B4

    Publication: 19095007;

  90. Identification of measles virus epitopes using an ultra-fast method of panning phage-displayed random peptide libraries.

    ID: 1621366

    Description: epitope description:TTTWYSW host organism:Homo sapiens antibody name:2B4

    Publication: 19095007;

  91. Identification of measles virus epitopes using an ultra-fast method of panning phage-displayed random peptide libraries.

    ID: 1621399

    Description: epitope description:YNNHALL host organism:Homo sapiens antibody name:3B

    Publication: 19095007;

  92. Comparative immunogenicity evaluations of influenza A virus M2 peptide as recombinant virus like particle or conjugate vaccines in mice and monkeys.

    ID: 1621436

    Description: epitope description:SLLTEVETPIRNEWGCRCNDSSD antigen name:Matrix protein 2 host organism:Mus musculus BALB/c

    Publication: 19146898;

  93. Broad cross-protection against H5N1 avian influenza virus infection by means of monoclonal antibodies that map to conserved viral epitopes.

    ID: 1627663

    Description: epitope description:K168, N198 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:20A11, 16F13, 13D4, 16G3, 20H2, 14E4

    Publication: 19032063;

  94. Antigenic characterization and cytolocalization of P35, the major Mycoplasma penetrans antigen.

    ID: 1627682

    Description: epitope description:KATPNDGY antigen name:Lipoprotein p35 host organism:Oryctolagus cuniculus

    Publication: 10075417;

  95. A simple screening method for detecting bindings between oligopeptides and HLA-DR molecules on filter papers: possible application for mapping of puta...

    ID: 1627706

    Description: epitope description:SSRKKITCE antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 10832968;

  96. A simple screening method for detecting bindings between oligopeptides and HLA-DR molecules on filter papers: possible application for mapping of puta...

    ID: 1627714

    Description: epitope description:CTKPDSYPL antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 10832968;

  97. A simple screening method for detecting bindings between oligopeptides and HLA-DR molecules on filter papers: possible application for mapping of puta...

    ID: 1627717

    Description: epitope description:PDSYPLFDG antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 10832968;

  98. A simple screening method for detecting bindings between oligopeptides and HLA-DR molecules on filter papers: possible application for mapping of puta...

    ID: 1627719

    Description: epitope description:SYPLFDGIF antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 10832968;

  99. A simple screening method for detecting bindings between oligopeptides and HLA-DR molecules on filter papers: possible application for mapping of puta...

    ID: 1627720

    Description: epitope description:YPLFDGIFC antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 10832968;

  100. A simple screening method for detecting bindings between oligopeptides and HLA-DR molecules on filter papers: possible application for mapping of puta...

    ID: 1627722

    Description: epitope description:LFDGIFCSS antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 10832968;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston