Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270564

    Description: epitope description:WNNKTPNSIA antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  2. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270567

    Description: epitope description:KIDKLCVWNN antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  3. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270573

    Description: epitope description:VWNNKTPNSI antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  4. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270582

    Description: epitope description:TPNSIAAISM antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  5. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270583

    Description: epitope description:PNSIAAISME antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  6. Mapping a neutralizing epitope on the SARS coronavirus spike protein: computational prediction based on affinity-selected peptides.

    ID: 1270683

    Description: epitope description:PMHECLSAPSVCADNY host organism:Homo sapiens antibody name:80R

    Publication: 16630634;

  7. Mapping a neutralizing epitope on the SARS coronavirus spike protein: computational prediction based on affinity-selected peptides.

    ID: 1270685

    Description: epitope description:ETFTCISAPWTCVTWL host organism:Homo sapiens antibody name:80R

    Publication: 16630634;

  8. Mapping a neutralizing epitope on the SARS coronavirus spike protein: computational prediction based on affinity-selected peptides.

    ID: 1270692

    Description: epitope description:TPPRCSDQMYCSLSR host organism:Homo sapiens antibody name:80R

    Publication: 16630634;

  9. Mapping a neutralizing epitope on the SARS coronavirus spike protein: computational prediction based on affinity-selected peptides.

    ID: 1270693

    Description: epitope description:THQFCPDPKHCLAQP host organism:Homo sapiens antibody name:80R

    Publication: 16630634;

  10. Mapping a neutralizing epitope on the SARS coronavirus spike protein: computational prediction based on affinity-selected peptides.

    ID: 1270696

    Description: epitope description:TSNFCPAGGPCSPHG host organism:Homo sapiens antibody name:80R

    Publication: 16630634;

  11. Mapping a neutralizing epitope on the SARS coronavirus spike protein: computational prediction based on affinity-selected peptides.

    ID: 1270709

    Description: epitope description:NNWPCLNETCPTKG host organism:Homo sapiens antibody name:80R

    Publication: 16630634;

  12. Mapping a neutralizing epitope on the SARS coronavirus spike protein: computational prediction based on affinity-selected peptides.

    ID: 1270714

    Description: epitope description:RQTEPCNLWFCPQV host organism:Homo sapiens antibody name:80R

    Publication: 16630634;

  13. Mapping a neutralizing epitope on the SARS coronavirus spike protein: computational prediction based on affinity-selected peptides.

    ID: 1270724

    Description: epitope description:NLSCTHPLGSPPPAP host organism:Homo sapiens antibody name:80R

    Publication: 16630634;

  14. Mapping a neutralizing epitope on the SARS coronavirus spike protein: computational prediction based on affinity-selected peptides.

    ID: 1270727

    Description: epitope description:QTPPCPIEHCPSFYQ host organism:Homo sapiens antibody name:80R

    Publication: 16630634;

  15. Mapping a neutralizing epitope on the SARS coronavirus spike protein: computational prediction based on affinity-selected peptides.

    ID: 1270729

    Description: epitope description:PNCWVGLTGAHSCFL host organism:Homo sapiens antibody name:80R

    Publication: 16630634;

  16. Mapping a neutralizing epitope on the SARS coronavirus spike protein: computational prediction based on affinity-selected peptides.

    ID: 1270730

    Description: epitope description:THSVPVAYPWPDLNA host organism:Homo sapiens antibody name:80R

    Publication: 16630634;

  17. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1270758

    Description: epitope description:HWRCPPRR antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  18. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1270765

    Description: epitope description:RRRAGRCP antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  19. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1270766

    Description: epitope description:RAGRCPPR antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  20. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1270770

    Description: epitope description:QTEKFVKE antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  21. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1270772

    Description: epitope description:EKFVKEQR antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  22. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1270773

    Description: epitope description:KFVKEQRE antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  23. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1270774

    Description: epitope description:FVKEQREA antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  24. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1270777

    Description: epitope description:EQREAEGG antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  25. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1270785

    Description: epitope description:SKVPEDTL antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  26. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1270798

    Description: epitope description:AEAEGGTW antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  27. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1270810

    Description: epitope description:HQVGDGEA antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  28. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1270814

    Description: epitope description:EAGPGVAG antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  29. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1270823

    Description: epitope description:GASDLRSS antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  30. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1270824

    Description: epitope description:ASDLRSSS antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  31. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1270825

    Description: epitope description:SDLRSSSG antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  32. Localisation of linear epitopes at the carboxy-terminal end of the mycobacterial 71 kDa heat shock protein.

    ID: 1270826

    Description: epitope description:DLRSSSGC antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 1379682;

  33. Intranasal immunization with inactivated tick-borne encephalitis virus and the antigenic peptide 89-119 protects mice against intraperitoneal challeng...

    ID: 1270835

    Description: epitope description:GTVCKRDQSDRGWGNHAGLFGKGSIVTCVKA host organism:Mus musculus BALB/c

    Publication: 16545605;

  34. Mapping of the regions on the heavy chain of botulinum neurotoxin A (BoNT/A) recognized by antibodies of cervical dystonia patients with immunoresista...

    ID: 1270888

    Description: epitope description:EVILKNAIVYNSMYENFST antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens antibody name:Mouse prote...

    Publication: 16647121;

  35. Mapping of the regions on the heavy chain of botulinum neurotoxin A (BoNT/A) recognized by antibodies of cervical dystonia patients with immunoresista...

    ID: 1270890

    Description: epitope description:FNSISLNNEYTIINCMENN antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens antibody name:Mouse prote...

    Publication: 16647121;

  36. Mapping of the regions on the heavy chain of botulinum neurotoxin A (BoNT/A) recognized by antibodies of cervical dystonia patients with immunoresista...

    ID: 1270891

    Description: epitope description:CMENNSGWKVSLNYGEIIW antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens antibody name:Mouse prote...

    Publication: 16647121;

  37. Mapping of the regions on the heavy chain of botulinum neurotoxin A (BoNT/A) recognized by antibodies of cervical dystonia patients with immunoresista...

    ID: 1270896

    Description: epitope description:DQKPISNLGNIHASNNIMF antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens antibody name:Mouse prote...

    Publication: 16647121;

  38. Mapping of the regions on the heavy chain of botulinum neurotoxin A (BoNT/A) recognized by antibodies of cervical dystonia patients with immunoresista...

    ID: 1270897

    Description: epitope description:NNIMFKLDGCRDTHRYIWI antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens antibody name:Mouse prote...

    Publication: 16647121;

  39. Mapping of the regions on the heavy chain of botulinum neurotoxin A (BoNT/A) recognized by antibodies of cervical dystonia patients with immunoresista...

    ID: 1270900

    Description: epitope description:NSGILKDFWGDYLQYDKPY antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens antibody name:Mouse prote...

    Publication: 16647121;

  40. Mapping of the regions on the heavy chain of botulinum neurotoxin A (BoNT/A) recognized by antibodies of cervical dystonia patients with immunoresista...

    ID: 1270901

    Description: epitope description:YDKPYYMLNLYDPNKYVDV antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens antibody name:Mouse prote...

    Publication: 16647121;

  41. Mapping of the regions on the heavy chain of botulinum neurotoxin A (BoNT/A) recognized by antibodies of cervical dystonia patients with immunoresista...

    ID: 1270903

    Description: epitope description:YLKGPRGSVMTTNIYLNSS antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens antibody name:Mouse prote...

    Publication: 16647121;

  42. Mapping of the regions on the heavy chain of botulinum neurotoxin A (BoNT/A) recognized by antibodies of cervical dystonia patients with immunoresista...

    ID: 1270904

    Description: epitope description:YLNSSLYRGTKFIIKKYAS antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens antibody name:Mouse prote...

    Publication: 16647121;

  43. Mapping of the regions on the heavy chain of botulinum neurotoxin A (BoNT/A) recognized by antibodies of cervical dystonia patients with immunoresista...

    ID: 1270906

    Description: epitope description:NDRVYINVVVKNKEYRLAT antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens antibody name:Mouse prote...

    Publication: 16647121;

  44. A 27 amino acid coding region of JE virus E protein expressed in E. coli as fusion protein with glutathione-S-transferase elicit neutralizing antibody...

    ID: 1270914

    Description: epitope description:EAHNEKRADSSYVCKQGFTDRGWGNGC antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 8822638;

  45. Genotype 1 and genotype 2 bovine noroviruses are antigenically distinct but share a cross-reactive epitope with human noroviruses.

    ID: 1271051

    Description: epitope description:PTAGAQIAA antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody name:CM39

    Publication: 16517888;

  46. Genotype 1 and genotype 2 bovine noroviruses are antigenically distinct but share a cross-reactive epitope with human noroviruses.

    ID: 1271055

    Description: epitope description:PTAGAQIAA antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody name:CM39

    Publication: 16517888;

  47. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1271057

    Description: epitope description:GKREMVIITF antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus C57BL/10

    Publication: 8606092;

  48. Genotype 1 and genotype 2 bovine noroviruses are antigenically distinct but share a cross-reactive epitope with human noroviruses.

    ID: 1271061

    Description: epitope description:PTAGAQIAA antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody name:CM39

    Publication: 16517888;

  49. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1271064

    Description: epitope description:EMVIITFKSG antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus C57BL/10

    Publication: 8606092;

  50. Template-based coiled-coil antigens elicit neutralizing antibodies to the SARS-coronavirus.

    ID: 1271071

    Description: epitope description:N1155, A1156, S1157, V1159, N1160, Q1162, K1163, E1164, D1166, R1167, N1169, E1170, V1171, K1173, N1174, N1176, E1177, S1178 antig...

    Publication: 16697221;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston