Plasmodium falciparum: sera of individuals living in a malaria-endemic region recognize peptide motifs of the human erythrocyte anion transport protei...

ID: 1381855

Description: epitope description:TFGGLLGEKT antigen name:Band 3 anion transport protein host organism:Homo sapiens

Plasmodium falciparum: sera of individuals living in a malaria-endemic region recognize peptide motifs of the human erythrocyte anion transport protei...

ID: 1381858

Description: epitope description:LLGEKTRNQM antigen name:Band 3 anion transport protein host organism:Homo sapiens

Identification and characterization of human B-cell epitopes in recombinant antigens of Leishmania aethiopica.

ID: 1379440

Description: epitope description:VLAVDAPN antigen name:Other Leishmania infantum protein host organism:Homo sapiens

Identification and characterization of human B-cell epitopes in recombinant antigens of Leishmania aethiopica.

ID: 1379442

Description: epitope description:TAGRFDSP antigen name:Other Leishmania infantum protein host organism:Homo sapiens

Identification and characterization of human B-cell epitopes in recombinant antigens of Leishmania aethiopica.

ID: 1379444

Description: epitope description:VWSILNRI antigen name:Other Leishmania infantum protein host organism:Homo sapiens

Identification and characterization of human B-cell epitopes in recombinant antigens of Leishmania aethiopica.

ID: 1379445

Description: epitope description:LNRIVRTL antigen name:Other Leishmania infantum protein host organism:Homo sapiens

Identification and characterization of human B-cell epitopes in recombinant antigens of Leishmania aethiopica.

ID: 1379446

Description: epitope description:VRTLLHGG antigen name:Leishmania aethiopica protein host organism:Homo sapiens

Identification and characterization of human B-cell epitopes in recombinant antigens of Leishmania aethiopica.

ID: 1379456

Description: epitope description:HAFCHEEG antigen name:Leishmania aethiopica protein host organism:Homo sapiens

Monoclonal antibodies targeting the HR2 domain and the region immediately upstream of the HR2 of the S protein neutralize in vitro infection of severe...

ID: 1379481

Description: epitope description:ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYI antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:1G10

Antibody reactivity to an Epstein-Barr virus BERF4-encoded epitope occurring also in Asp-57 region of HLA-DQ8 beta chain. Childhood Diabetes in Finlan...

ID: 1379488

Description: epitope description:GPPAA antigen name:Epstein-Barr nuclear antigen 6 host organism:Homo sapiens

Antibody reactivity to an Epstein-Barr virus BERF4-encoded epitope occurring also in Asp-57 region of HLA-DQ8 beta chain. Childhood Diabetes in Finlan...

ID: 1379498

Description: epitope description:GRPVA antigen name:HLA class II histocompatibility antigen, DRB1-7 beta chain host organism:Homo sapiens

Antibody reactivity to an Epstein-Barr virus BERF4-encoded epitope occurring also in Asp-57 region of HLA-DQ8 beta chain. Childhood Diabetes in Finlan...

ID: 1379511

Description: epitope description:GRLDA antigen name:HLA class II histocompatibility antigen, DQ beta 1 chain (UniProt:P01920) host organism:Homo sapiens

Antibody reactivity to an Epstein-Barr virus BERF4-encoded epitope occurring also in Asp-57 region of HLA-DQ8 beta chain. Childhood Diabetes in Finlan...

ID: 1379512

Description: epitope description:GPPAAGPPAAGPPAA antigen name:Epstein-Barr nuclear antigen 6 host organism:Homo sapiens

Antibody reactivity to an Epstein-Barr virus BERF4-encoded epitope occurring also in Asp-57 region of HLA-DQ8 beta chain. Childhood Diabetes in Finlan...

ID: 1379517

Description: epitope description:GPPAAEYWNSQ antigen name:HLA class II histocompatibility antigen, DQ beta 1 chain (UniProt:P01920) host organism:Oryctolagus cunic...

Antibody reactivity to an Epstein-Barr virus BERF4-encoded epitope occurring also in Asp-57 region of HLA-DQ8 beta chain. Childhood Diabetes in Finlan...

ID: 1379526

Description: epitope description:TPLGPPAAEYW antigen name:HLA class II histocompatibility antigen, DQ beta 1 chain (UniProt:P01920) host organism:Homo sapiens

Antibody reactivity to an Epstein-Barr virus BERF4-encoded epitope occurring also in Asp-57 region of HLA-DQ8 beta chain. Childhood Diabetes in Finlan...

ID: 1379530

Description: epitope description:GPPAAEYGPPAAEY host organism:Oryctolagus cuniculus New Zealand White

Recognition of synthetic 104-mer and 102-mer peptides corresponding to N- and C-terminal nonrepeat regions of the Plasmodium falciparum circumsporozoi...

ID: 1379535

Description: epitope description:DNAGTNLYNELEMNYYGKQENWYSLKKNSRSLGENDDGNNN antigen name:Circumsporozoite (CS) protein host organism:Homo sapiens antibody name:Huma...

Recognition of synthetic 104-mer and 102-mer peptides corresponding to N- and C-terminal nonrepeat regions of the Plasmodium falciparum circumsporozoi...

ID: 1379537

Description: epitope description:KNNQGNGQGHNMPNDPNRNVDENANANN antigen name:Circumsporozoite (CS) protein host organism:Homo sapiens antibody name:Human sera

Recognition of synthetic 104-mer and 102-mer peptides corresponding to N- and C-terminal nonrepeat regions of the Plasmodium falciparum circumsporozoi...

ID: 1379538

Description: epitope description:NAVKNNNNEEPSDKHIEQYLKKIKNSISTEW antigen name:Circumsporozoite (CS) protein host organism:Homo sapiens antibody name:Human sera

Antibody reactivity to an Epstein-Barr virus BERF4-encoded epitope occurring also in Asp-57 region of HLA-DQ8 beta chain. Childhood Diabetes in Finlan...

ID: 1379539

Description: epitope description:TPQGRPVAEYW antigen name:HLA class II histocompatibility antigen, DQ beta 1 chain (UniProt:P01920) host organism:Homo sapiens

Antibody reactivity to an Epstein-Barr virus BERF4-encoded epitope occurring also in Asp-57 region of HLA-DQ8 beta chain. Childhood Diabetes in Finlan...

ID: 1379553

Description: epitope description:TPLGRLDAEYW antigen name:HLA class II histocompatibility antigen, DQ beta 1 chain (UniProt:P01920) host organism:Oryctolagus cunic...

Antibody reactivity to an Epstein-Barr virus BERF4-encoded epitope occurring also in Asp-57 region of HLA-DQ8 beta chain. Childhood Diabetes in Finlan...

ID: 1379554

Description: epitope description:TPLGRLDAEYW antigen name:HLA class II histocompatibility antigen, DQ beta 1 chain (UniProt:P01920) host organism:Homo sapiens

Short report: identification of B-cell epitopes in the serine-rich Entamoeba histolytica protein.

ID: 1379559

Description: epitope description:ESSSSDKP antigen name:Serine-rich protein host organism:Homo sapiens antibody name:human serum

Short report: identification of B-cell epitopes in the serine-rich Entamoeba histolytica protein.

ID: 1379563

Description: epitope description:SSSDKPDN antigen name:Serine-rich protein host organism:Homo sapiens antibody name:human serum

Short report: identification of B-cell epitopes in the serine-rich Entamoeba histolytica protein.

ID: 1379565

Description: epitope description:KPEASSTN antigen name:Serine-rich protein host organism:Homo sapiens antibody name:human serum

Short report: identification of B-cell epitopes in the serine-rich Entamoeba histolytica protein.

ID: 1379566

Description: epitope description:SSTNKPEA antigen name:Serine-rich protein host organism:Homo sapiens antibody name:human serum

Short report: identification of B-cell epitopes in the serine-rich Entamoeba histolytica protein.

ID: 1379568

Description: epitope description:NSNDKSGS antigen name:Serine-rich protein host organism:Homo sapiens antibody name:human serum

Short report: identification of B-cell epitopes in the serine-rich Entamoeba histolytica protein.

ID: 1379569

Description: epitope description:KSGSSSDN antigen name:Serine-rich protein host organism:Homo sapiens antibody name:human serum

Short report: identification of B-cell epitopes in the serine-rich Entamoeba histolytica protein.

ID: 1379570

Description: epitope description:NDKSGSSS antigen name:Serine-rich protein host organism:Homo sapiens antibody name:human serum

Short report: identification of B-cell epitopes in the serine-rich Entamoeba histolytica protein.

ID: 1379585

Description: epitope description:YGVFLKNE antigen name:Serine-rich protein host organism:Homo sapiens antibody name:human serum

Short report: identification of B-cell epitopes in the serine-rich Entamoeba histolytica protein.

ID: 1379586

Description: epitope description:VFLKNEAS antigen name:Serine-rich protein host organism:Homo sapiens antibody name:human serum

Short report: identification of B-cell epitopes in the serine-rich Entamoeba histolytica protein.

ID: 1379592

Description: epitope description:EEAEEKEK antigen name:Serine-rich protein host organism:Homo sapiens antibody name:human serum

Short report: identification of B-cell epitopes in the serine-rich Entamoeba histolytica protein.

ID: 1379595

Description: epitope description:EKSSSAKP antigen name:Serine-rich protein host organism:Homo sapiens antibody name:human serum

Short report: identification of B-cell epitopes in the serine-rich Entamoeba histolytica protein.

ID: 1379599

Description: epitope description:SSNEDNED antigen name:Serine-rich protein host organism:Homo sapiens antibody name:human serum

Short report: identification of B-cell epitopes in the serine-rich Entamoeba histolytica protein.

ID: 1379602

Description: epitope description:EDDEDEKA antigen name:Serine-rich protein host organism:Homo sapiens antibody name:human serum

Short report: identification of B-cell epitopes in the serine-rich Entamoeba histolytica protein.

ID: 1379605

Description: epitope description:KASSSDNS antigen name:Serine-rich protein host organism:Homo sapiens antibody name:human serum

Short report: identification of B-cell epitopes in the serine-rich Entamoeba histolytica protein.

ID: 1379611

Description: epitope description:SDKPEASS antigen name:Serine-rich protein host organism:Homo sapiens antibody name:human serum

Short report: identification of B-cell epitopes in the serine-rich Entamoeba histolytica protein.

ID: 1379614

Description: epitope description:EASSTSNS antigen name:Serine-rich protein host organism:Homo sapiens antibody name:human serum

Short report: identification of B-cell epitopes in the serine-rich Entamoeba histolytica protein.

ID: 1379621

Description: epitope description:NNLDAASS antigen name:Serine-rich protein host organism:Homo sapiens antibody name:human serum

Short report: identification of B-cell epitopes in the serine-rich Entamoeba histolytica protein.

ID: 1379625

Description: epitope description:PFIVFCAI antigen name:Serine-rich protein host organism:Homo sapiens antibody name:human serum

Location of monoclonal antibody binding sites in the capsid protein of feline calicivirus.

ID: 1379634

Description: epitope description:DTTIPGELIPAGDYAITNGTGNDITTATGYDTADIIK antigen name:Capsid protein host organism:Mus musculus antibody name:4E7

Identification of the core residues of the epitope of a monoclonal antibody raised against glycoprotein D of herpes simplex virus type 1 by screening ...

ID: 1379636

Description: epitope description:FFHNGRFSDALRFTL host organism:Mus musculus BALB/c antibody name:A16

Identification of the core residues of the epitope of a monoclonal antibody raised against glycoprotein D of herpes simplex virus type 1 by screening ...

ID: 1379638

Description: epitope description:FFHNGRFSDALRFTL host organism:Mus musculus BALB/c antibody name:A16

Characterization of human monoclonal antibodies directed against the pp65-kD matrix antigen of human cytomegalovirus.

ID: 1379663

Description: epitope description:KPGKIS antigen name:65 kDa phosphoprotein host organism:Homo sapiens antibody name:MO58

Characterization of human monoclonal antibodies directed against the pp65-kD matrix antigen of human cytomegalovirus.

ID: 1379664

Description: epitope description:KPGKIS antigen name:65 kDa phosphoprotein host organism:Homo sapiens antibody name:MO58

Direct lysis of Trypanosoma cruzi: a novel effector mechanism of protection mediated by human anti-gal antibodies.

ID: 1379666

Description: epitope description:alpha-D-galactosyl-(1->3)-D-galactosyl group antigen name:polysaccharide host organism:Homo sapiens

Characterization of human monoclonal antibodies directed against the pp65-kD matrix antigen of human cytomegalovirus.

ID: 1379669

Description: epitope description:M208, E209, N210, T211, R212, A213, T214, K215, M216, M280, I281, I282, K283, P284, G285 antigen name:65 kDa phosphoprotein host o...

Widespread reactivity of human sera with a variant repeat of the circumsporozoite protein of Plasmodium vivax.

ID: 1379673

Description: epitope description:ANGAGNQPGANGAGNQPGANGAGNQPGANGAGNQPG antigen name:Circumsporozoite protein, putative host organism:Mus musculus

Epitope changes on the haemagglutinin molecule of recently isolated H1N1 influenza viruses.

ID: 1379679

Description: epitope description:R125 antigen name:Hemagglutinin host organism:Mus musculus antibody name:mAb 110

Antibodies to hepatitis B surface antigen (HBsAg) elicited by immunization with a synthetic peptide covalently linked to liposomes.

ID: 1379684

Description: epitope description:PSCCCTKPSDGNCTCIPIPSS antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

Widespread reactivity of human sera with a variant repeat of the circumsporozoite protein of Plasmodium vivax.

ID: 1379689

Description: epitope description:NAAGNAAGNAAGNAAG antigen name:Circumsporozoite protein host organism:Mus musculus A/J

Widespread reactivity of human sera with a variant repeat of the circumsporozoite protein of Plasmodium vivax.

ID: 1379690

Description: epitope description:NAAGNAAGNAAGNAAG antigen name:Circumsporozoite protein host organism:Mus musculus

A novel recombinant multiepitope protein as a hepatitis C diagnostic intermediate of high sensitivity and specificity.

ID: 1379700

Description: epitope description:MSTLPKPQRQTKRNTPRRPQNVKFPGGGQIVGGVYVLPRRGPRL antigen name:Genome polyprotein host organism:Mus musculus

Monoclonal antibodies to hepatitis B surface antigen (HBsAg) with anti-alpha specificity recognize a synthetic peptide analogue (S135-155) with unmodi...

ID: 1379750

Description: epitope description:PSCCCTKPSDGNCTCIPIPSS antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:anti-a group mAb 5D3

Isotype-specific immune response to a single hepatitis C virus core epitope defined by a human monoclonal antibody: diagnostic value and correlation t...

ID: 1379756

Description: epitope description:VYLLPR antigen name:Genome polyprotein host organism:Homo sapiens

Characterization of a natural human antibody with anti-galactosyl(alpha 1-2)galactose specificity that is present at high titers in chronic Trypanosom...

ID: 1379789

Description: epitope description:alpha-D-galactosyl-(1->2)-D-galactosyl group antigen name:N-glycan host organism:Homo sapiens

Chemically synthesized peptides elicit neutralizing antibody to bovine enterovirus.

ID: 1379803

Description: epitope description:TSITHWRIDF antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:mouse sera

Chemically synthesized peptides elicit neutralizing antibody to bovine enterovirus.

ID: 1379806

Description: epitope description:PSNQDSFQWQ antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:mouse sera

Chemically synthesized peptides elicit neutralizing antibody to bovine enterovirus.

ID: 1379815

Description: epitope description:VSVQDALDAQ antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:mouse sera

Use of synthetic peptides in the study of the antibody response to Plasmodium vivax sporozoites.

ID: 1379852

Description: epitope description:DGQPAGDRADGQPAGDRA antigen name:Circumsporozoite protein, putative host organism:Mus musculus antibody name:Mab 2F2

Immunological characteristics of a recombinant hepatitis B virus-derived multiple-epitope polypeptide: a study in polyvalent vaccine design.

ID: 1379854

Description: epitope description:HQLDPAFGANSTNPDWDFNP antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbi...

Immunological characteristics of a recombinant hepatitis B virus-derived multiple-epitope polypeptide: a study in polyvalent vaccine design.

ID: 1379863

Description: epitope description:CTTPAQGNSMFPSCCCTKPTDGNC antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White antibody name:R...

Use of synthetic peptides in the study of the antibody response to Plasmodium vivax sporozoites.

ID: 1379864

Description: epitope description:DRADGQPAGDRADGQPAGDRAAGQPAGDRAAGQPAGDRADGQPAG antigen name:Circumsporozoite protein, putative host organism:Homo sapiens

Immunological characteristics of a recombinant hepatitis B virus-derived multiple-epitope polypeptide: a study in polyvalent vaccine design.

ID: 1379867

Description: epitope description:HQLDPAFGANSTNPDWDFNP antigen name:Large envelope protein host organism:Mus musculus B10.A antibody name:Mouse sera

Immunological characteristics of a recombinant hepatitis B virus-derived multiple-epitope polypeptide: a study in polyvalent vaccine design.

ID: 1379870

Description: epitope description:HQLDPAFGANSTNPDWDFNP antigen name:Large envelope protein host organism:Mus musculus B10.A(3R) antibody name:Mouse sera

Immunological characteristics of a recombinant hepatitis B virus-derived multiple-epitope polypeptide: a study in polyvalent vaccine design.

ID: 1379873

Description: epitope description:CTTPAQGNSMFPSCCCTKPTDGNC antigen name:Large envelope protein host organism:Mus musculus B10.A antibody name:Mouse sera

Immunological characteristics of a recombinant hepatitis B virus-derived multiple-epitope polypeptide: a study in polyvalent vaccine design.

ID: 1379875

Description: epitope description:CTTPAQGNSMFPSCCCTKPTDGNC antigen name:Large envelope protein host organism:Mus musculus FVB antibody name:Mouse sera

Immunological characteristics of a recombinant hepatitis B virus-derived multiple-epitope polypeptide: a study in polyvalent vaccine design.

ID: 1379877

Description: epitope description:ALHQALQDPRVRGL antigen name:Large envelope protein host organism:Mus musculus B10.M antibody name:Mouse sera

Immunological characteristics of a recombinant hepatitis B virus-derived multiple-epitope polypeptide: a study in polyvalent vaccine design.

ID: 1379879

Description: epitope description:ALHQALQDPRVRGL antigen name:Large envelope protein host organism:Mus musculus B10.A(3R) antibody name:Mouse sera

Immunological characteristics of a recombinant hepatitis B virus-derived multiple-epitope polypeptide: a study in polyvalent vaccine design.

ID: 1379881

Description: epitope description:HQLDPAFGANSTNPDWDFNP antigen name:Large envelope protein host organism:Mus musculus B10.A antibody name:Mouse sera

Immunological characteristics of a recombinant hepatitis B virus-derived multiple-epitope polypeptide: a study in polyvalent vaccine design.

ID: 1379883

Description: epitope description:ALHQALQDPRVRGL antigen name:Large envelope protein host organism:Mus musculus B10.A antibody name:Mouse sera

Comparison of immune responses to a native viral antigen and a synthetic peptide derived from it: implications for vaccine development.

ID: 1379920

Description: epitope description:CTTPAQGNSMFPSCCCTKPTDGNC + MYRI(C1) antigen name:Large envelope protein host organism:Mus musculus antibody name:mouse sera

Antigenic mimicry of an immunoglobulin A epitope by a hepatitis B virus cell attachment site.

ID: 1379954

Description: epitope description:PAFRANTANPDWDFNPNKDTWPDANKV antigen name:Large envelope protein host organism:Oryctolagus cuniculus antibody name:Rabbit anti-21-4...

Antigenic mimicry of an immunoglobulin A epitope by a hepatitis B virus cell attachment site.

ID: 1379962

Description: epitope description:VQGFFPQQPLSVTWSESGEGVTARDFPP antigen name:Other Homo sapiens (human) protein host organism:Oryctolagus cuniculus antibody name:Rab...

Antigenic mimicry of an immunoglobulin A epitope by a hepatitis B virus cell attachment site.

ID: 1379963

Description: epitope description:VQGFFPQQPLSVTWSESGEGVTARDFPP antigen name:Other Homo sapiens (human) protein host organism:Oryctolagus cuniculus antibody name:Rab...

Location of monoclonal antibody binding sites in the capsid protein of feline calicivirus.

ID: 1380009

Description: epitope description:DTTIPGELIPAGDYAITNGTGNDITTATGYDTADIIK antigen name:Capsid protein host organism:Mus musculus antibody name:4E7, 1G9

Epitope mapping of the PreS1 domain of the hepatitis B virus large surface protein.

ID: 1380116

Description: epitope description:GGVLGWS antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:mAb 116-72

Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

ID: 1380130

Description: epitope description:ISNRDF antigen name:Genome polyprotein host organism:Homo sapiens

Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

ID: 1380135

Description: epitope description:FVEGVS antigen name:Genome polyprotein host organism:Homo sapiens

Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

ID: 1380138

Description: epitope description:GVSGGS antigen name:Genome polyprotein host organism:Homo sapiens

Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

ID: 1380144

Description: epitope description:WVDIVL antigen name:Genome polyprotein host organism:Homo sapiens

Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

ID: 1380146

Description: epitope description:DIVLEH antigen name:Genome polyprotein host organism:Homo sapiens

Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

ID: 1380149

Description: epitope description:LEHGSC antigen name:Genome polyprotein host organism:Homo sapiens

Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

ID: 1380153

Description: epitope description:SCVTTM antigen name:Genome polyprotein host organism:Homo sapiens

Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

ID: 1380155

Description: epitope description:VTTMAK antigen name:Genome polyprotein host organism:Homo sapiens

Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

ID: 1380163

Description: epitope description:PTLDFE antigen name:Genome polyprotein host organism:Homo sapiens

Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

ID: 1380169

Description: epitope description:IKTEAK antigen name:Genome polyprotein host organism:Homo sapiens

Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

ID: 1380170

Description: epitope description:KTEAKQ antigen name:Genome polyprotein host organism:Homo sapiens

Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

ID: 1380178

Description: epitope description:TLRKYC antigen name:Genome polyprotein host organism:Homo sapiens

Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

ID: 1380181

Description: epitope description:KYCIEA antigen name:Genome polyprotein host organism:Homo sapiens

Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

ID: 1380191

Description: epitope description:TTTESR antigen name:Genome polyprotein host organism:Homo sapiens

Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

ID: 1380195

Description: epitope description:SRCPTQ antigen name:Genome polyprotein host organism:Homo sapiens

Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

ID: 1380201

Description: epitope description:GEPSLN antigen name:Genome polyprotein host organism:Homo sapiens

Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

ID: 1380207

Description: epitope description:EEQDKR antigen name:Genome polyprotein host organism:Homo sapiens

Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

ID: 1380214

Description: epitope description:LCKHSM antigen name:Genome polyprotein host organism:Homo sapiens

Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

ID: 1380217

Description: epitope description:HSMVDR antigen name:Genome polyprotein host organism:Homo sapiens

Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

ID: 1380224

Description: epitope description:WGNGCG antigen name:Genome polyprotein host organism:Homo sapiens

Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

ID: 1380236

Description: epitope description:IVTCAM antigen name:Genome polyprotein host organism:Homo sapiens

Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

ID: 1380237

Description: epitope description:VTCAMF antigen name:Genome polyprotein host organism:Homo sapiens

Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

ID: 1380244

Description: epitope description:CKKNME antigen name:Genome polyprotein host organism:Homo sapiens