Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. IgE epitopes on the cat (Felis domesticus) major allergen Fel d I: a study with overlapping synthetic peptides.

    ID: 1474944

    Description: epitope description:EICPAVKRDVDLFLTG antigen name:Fel d 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 7508463;

  2. IgE epitopes on the cat (Felis domesticus) major allergen Fel d I: a study with overlapping synthetic peptides.

    ID: 1474948

    Description: epitope description:KKIQDCYVENGLIS antigen name:Major allergen I polypeptide chain 2 host organism:Homo sapiens antibody name:patient sera

    Publication: 7508463;

  3. IgE epitopes on the cat (Felis domesticus) major allergen Fel d I: a study with overlapping synthetic peptides.

    ID: 1474960

    Description: epitope description:MTTISSSKDCMGEA antigen name:Major allergen I polypeptide chain 2 host organism:Homo sapiens antibody name:patient sera

    Publication: 7508463;

  4. IgE epitopes on the cat (Felis domesticus) major allergen Fel d I: a study with overlapping synthetic peptides.

    ID: 1474961

    Description: epitope description:KDCMGEAVQNTVED antigen name:Major allergen I polypeptide chain 2 host organism:Homo sapiens antibody name:patient sera

    Publication: 7508463;

  5. IgE epitopes on the cat (Felis domesticus) major allergen Fel d I: a study with overlapping synthetic peptides.

    ID: 1474969

    Description: epitope description:EICPAVKRDVDLFLTG antigen name:Fel d 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 7508463;

  6. IgE epitopes on the cat (Felis domesticus) major allergen Fel d I: a study with overlapping synthetic peptides.

    ID: 1474974

    Description: epitope description:VAQYKALPVVLENA antigen name:Fel d 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 7508463;

  7. IgE epitopes on the cat (Felis domesticus) major allergen Fel d I: a study with overlapping synthetic peptides.

    ID: 1474983

    Description: epitope description:LLDKIYTSPLC antigen name:Other Felis catus (cat) protein host organism:Homo sapiens antibody name:patient sera

    Publication: 7508463;

  8. IgE epitopes on the cat (Felis domesticus) major allergen Fel d I: a study with overlapping synthetic peptides.

    ID: 1474987

    Description: epitope description:EICPAVKRDVDLFLTG antigen name:Fel d 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 7508463;

  9. IgE epitopes on the cat (Felis domesticus) major allergen Fel d I: a study with overlapping synthetic peptides.

    ID: 1474988

    Description: epitope description:VKMAETCPIFYDVF antigen name:Major allergen I polypeptide chain 2 host organism:Homo sapiens antibody name:patient sera

    Publication: 7508463;

  10. Development and application of monoclonal antibodies against avian influenza virus nucleoprotein.

    ID: 1474996

    Description: epitope description:FDERRNKYLEEHPSAGKDPKKTGGPI antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:mAb F26-9

    Publication: 18006085;

  11. IgE epitopes on the cat (Felis domesticus) major allergen Fel d I: a study with overlapping synthetic peptides.

    ID: 1475010

    Description: epitope description:FAVANGNELLLDLS antigen name:Major allergen I polypeptide chain 2 host organism:Homo sapiens antibody name:affinity-purified patien...

    Publication: 7508463;

  12. Validation of peptide epitope microarray experiments and extraction of quality data.

    ID: 1475015

    Description: epitope description:ANRHVKPTGSAVVGL antigen name:Diacylglycerol acyltransferase/mycolyltransferase Ag85A (UniProt:P9WQP3) host organism:Homo sapiens

    Publication: 17765917;

  13. Validation of peptide epitope microarray experiments and extraction of quality data.

    ID: 1475017

    Description: epitope description:AGGGHNGVFDFPDSG antigen name:Diacylglycerol acyltransferase/mycolyltransferase Ag85A (UniProt:P9WQP3) host organism:Homo sapiens

    Publication: 17765917;

  14. Validation of peptide epitope microarray experiments and extraction of quality data.

    ID: 1475019

    Description: epitope description:PAGGAYSMYTNWEQD antigen name:MPT51/MPB51 antigen host organism:Homo sapiens

    Publication: 17765917;

  15. Validation of peptide epitope microarray experiments and extraction of quality data.

    ID: 1475021

    Description: epitope description:LQSLGAEIAVEQAAL antigen name:ESAT-6-like protein EsxH host organism:Homo sapiens

    Publication: 17765917;

  16. Validation of peptide epitope microarray experiments and extraction of quality data.

    ID: 1475023

    Description: epitope description:LKTQIDQVESTAG antigen name:ESAT-6-like protein EsxB host organism:Homo sapiens

    Publication: 17765917;

  17. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475034

    Description: epitope description:GFRINTNVAALNAKANADLNSKSLDASLSR antigen name:Flagellin A host organism:Oryctolagus cuniculus New Zealand White

    Publication: 17704944;

  18. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475035

    Description: epitope description:GFRINTNVAALNAKANADLNSKSLDASLSR antigen name:Flagellin A host organism:Oryctolagus cuniculus New Zealand White

    Publication: 17704944;

  19. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475043

    Description: epitope description:DASLSRLSSGLRINSAADDASGMAIADSLR antigen name:Flagellin A host organism:Oryctolagus cuniculus New Zealand White

    Publication: 17704944;

  20. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475051

    Description: epitope description:ADSLRSQANTLGQAISNGNDALGILQTADK antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  21. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475057

    Description: epitope description:QTADKAMDEQLKILDTIKTKATQAAQDGQS antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  22. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475060

    Description: epitope description:QTADKAMDEQLKILDTIKTKATQAAQDGQS antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  23. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475061

    Description: epitope description:QTADKAMDEQLKILDTIKTKATQAAQDGQS antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  24. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475063

    Description: epitope description:QTADKAMDEQLKILDTIKTKATQAAQDGQS antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  25. Serological assessment of synthetic peptides of Campylobacter jejuni NCTC11168 FlaA protein using antibodies against multiple serotypes.

    ID: 1475067

    Description: epitope description:QDGQSLKTRTMLQADINRLMEELDNIANTT antigen name:Flagellin A host organism:Gallus gallus Leghorn

    Publication: 17704944;

  26. Immunological priming with synthetic peptides of foot-and-mouth disease virus.

    ID: 1465674

    Description: epitope description:RHKQKIVAPVKQTL antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:Anti-peptide 200-213 sera

    Publication: 2997370;

  27. Trypanosoma cruzi: immune response and functional heart damage induced in mice by the main linear B-cell epitope of parasite ribosomal P proteins.

    ID: 1465684

    Description: epitope description:EEEDDD antigen name:Other Trypanosoma cruzi protein host organism:Mus musculus BALB/c

    Publication: 9562426;

  28. Detection of the myristylated gag-raf transforming protein with raf-specific antipeptide sera.

    ID: 1465807

    Description: epitope description:PKINRSASEPSL antigen name:RAF proto-oncogene serine/threonine-protein kinase host organism:Oryctolagus cuniculus

    Publication: 2994296;

  29. Detection of the myristylated gag-raf transforming protein with raf-specific antipeptide sera.

    ID: 1465809

    Description: epitope description:CTLTTSPRLPVF antigen name:MOS host organism:Oryctolagus cuniculus

    Publication: 2994296;

  30. Detection of the myristylated gag-raf transforming protein with raf-specific antipeptide sera.

    ID: 1465812

    Description: epitope description:MAPEVIRMQDDNP antigen name:MOS host organism:Oryctolagus cuniculus

    Publication: 2994296;

  31. Detection of the myristylated gag-raf transforming protein with raf-specific antipeptide sera.

    ID: 1465815

    Description: epitope description:CTLTTSPRLPVF antigen name:MOS host organism:Oryctolagus cuniculus

    Publication: 2994296;

  32. Protection against foot-and-mouth disease by immunization with a chemically synthesized peptide predicted from the viral nucleotide sequence.

    ID: 1465819

    Description: epitope description:TTSAGESADPVTTTVENYGGETQIQRRQHTDVSFIMDRFVK antigen name:Polyprotein host organism:Oryctolagus cuniculus antibody name:Anti-peptide ...

    Publication: 7045684;

  33. Protection against foot-and-mouth disease by immunization with a chemically synthesized peptide predicted from the viral nucleotide sequence.

    ID: 1465831

    Description: epitope description:NYGGETQIQRRQHTDV antigen name:Polyprotein host organism:Oryctolagus cuniculus antibody name:Anti-peptide 17-32 sera

    Publication: 7045684;

  34. Protection against foot-and-mouth disease by immunization with a chemically synthesized peptide predicted from the viral nucleotide sequence.

    ID: 1465839

    Description: epitope description:VPNLRGDLQVLAQKVARTLP antigen name:Polyprotein host organism:Oryctolagus cuniculus antibody name:Anti-peptide 141-160 sera

    Publication: 7045684;

  35. Segregation of B and T cell epitopes of Treponema pallidum repeat protein K to variable and conserved regions during experimental syphilis infection.

    ID: 1465882

    Description: epitope description:ELAWGIASDGGALKHGFKTT antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit antise...

    Publication: 12097401;

  36. Segregation of B and T cell epitopes of Treponema pallidum repeat protein K to variable and conserved regions during experimental syphilis infection.

    ID: 1465883

    Description: epitope description:LKHGFKTTTDFKIVFPIVAK antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit antise...

    Publication: 12097401;

  37. Segregation of B and T cell epitopes of Treponema pallidum repeat protein K to variable and conserved regions during experimental syphilis infection.

    ID: 1465901

    Description: epitope description:CALAATDVGHKKNGAQGTVG antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit antise...

    Publication: 12097401;

  38. Segregation of B and T cell epitopes of Treponema pallidum repeat protein K to variable and conserved regions during experimental syphilis infection.

    ID: 1465906

    Description: epitope description:SDPDTSFLEGLDLGVDVRTY antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit antise...

    Publication: 12097401;

  39. Segregation of B and T cell epitopes of Treponema pallidum repeat protein K to variable and conserved regions during experimental syphilis infection.

    ID: 1465910

    Description: epitope description:WTANGDYKSKGDKPVYEPGF antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit antise...

    Publication: 12097401;

  40. Segregation of B and T cell epitopes of Treponema pallidum repeat protein K to variable and conserved regions during experimental syphilis infection.

    ID: 1465913

    Description: epitope description:IKVELTGNSTLSSDYAQARA antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit antise...

    Publication: 12097401;

  41. Segregation of B and T cell epitopes of Treponema pallidum repeat protein K to variable and conserved regions during experimental syphilis infection.

    ID: 1465916

    Description: epitope description:LDLGVDVRTYMPVHYKVLKA antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit antise...

    Publication: 12097401;

  42. Segregation of B and T cell epitopes of Treponema pallidum repeat protein K to variable and conserved regions during experimental syphilis infection.

    ID: 1465917

    Description: epitope description:MPVHYKVLKALPRADIHFPV antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit antise...

    Publication: 12097401;

  43. Segregation of B and T cell epitopes of Treponema pallidum repeat protein K to variable and conserved regions during experimental syphilis infection.

    ID: 1465920

    Description: epitope description:QVSFTPDIEGYAELAWGIAS antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus New Zealand White antibody name:pooled rabbit...

    Publication: 12097401;

  44. Trypanosoma cruzi: immune response and functional heart damage induced in mice by the main linear B-cell epitope of parasite ribosomal P proteins.

    ID: 1465921

    Description: epitope description:EEEDDD antigen name:Other Trypanosoma cruzi protein host organism:Mus musculus BALB/c

    Publication: 9562426;

  45. Protection against foot-and-mouth disease by immunization with a chemically synthesized peptide predicted from the viral nucleotide sequence.

    ID: 1465922

    Description: epitope description:VPNLRGDLQVLAQKVARTLP antigen name:Polyprotein host organism:Cavia porcellus antibody name:Guinea pig sera

    Publication: 7045684;

  46. Protection against foot-and-mouth disease by immunization with a chemically synthesized peptide predicted from the viral nucleotide sequence.

    ID: 1465934

    Description: epitope description:VPNLRGDLQVLAQKVARTLP antigen name:Polyprotein host organism:Oryctolagus cuniculus antibody name:Anti-peptide 141-160 sera

    Publication: 7045684;

  47. Protection against foot-and-mouth disease by immunization with a chemically synthesized peptide predicted from the viral nucleotide sequence.

    ID: 1465935

    Description: epitope description:RHKQKIVAPVKQTL antigen name:Polyprotein host organism:Oryctolagus cuniculus antibody name:Anti-peptide 200-213 sera

    Publication: 7045684;

  48. Antibody to a synthetic peptide detects a conserved region of retrovirus transmembrane proteins.

    ID: 1465971

    Description: epitope description:EVVLQNRRGLDLL antigen name:Envelope glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 3977884;

  49. Cysticercosis: towards the design of a diagnostic kit based on synthetic peptides.

    ID: 1465972

    Description: epitope description:GNLLLSCL antigen name:Protective recombinant antigen (UniProt:Q26874) host organism:Homo sapiens

    Publication: 10709780;

  50. Antibody to a synthetic peptide detects a conserved region of retrovirus transmembrane proteins.

    ID: 1465977

    Description: epitope description:EVVLQNRRGLDLL antigen name:Envelope glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 3977884;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston