Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. B- and T-cell responses in group a streptococcus M-protein- or Peptide-induced experimental carditis.

    ID: 1637676

    Description: epitope description:TVKDKIAKEQENKETIGTLK antigen name:UniProt:A2RGM0 host organism:Rattus norvegicus Lewis

    Publication: 19273562;

  2. B- and T-cell responses in group a streptococcus M-protein- or Peptide-induced experimental carditis.

    ID: 1637681

    Description: epitope description:NKISEASRKGLRRDLDASRE antigen name:UniProt:A2RGM0 host organism:Rattus norvegicus Lewis

    Publication: 19273562;

  3. B- and T-cell responses in group a streptococcus M-protein- or Peptide-induced experimental carditis.

    ID: 1637692

    Description: epitope description:AKKQVEKALEEANSLKAALE antigen name:UniProt:A2RGM0 host organism:Rattus norvegicus Lewis

    Publication: 19273562;

  4. B- and T-cell responses in group a streptococcus M-protein- or Peptide-induced experimental carditis.

    ID: 1637703

    Description: epitope description:TRQELANKQQESKENEKALN antigen name:UniProt:A2RGM0 host organism:Rattus norvegicus Lewis

    Publication: 19273562;

  5. Mapping of epitopes for autoantibodies to the type 1 diabetes autoantigen IA-2 by peptide phage display and molecular modeling: overlap of antibody an...

    ID: 1637714

    Description: epitope description:NPEDCFKTGCNSPT host organism:Homo sapiens antibody name:96/3

    Publication: 15034020;

  6. Epitope map of two polyclonal antibodies that recognize amyloid lesions in patients with Alzheimer's disease.

    ID: 1641683

    Description: epitope description:DAEFRHDSGYEVHHQKLVFFAEDVGSNK antigen name:Amyloid beta A4 protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1372166;

  7. Development and characterization of monoclonal antibodies specific for amylin.

    ID: 1641884

    Description: epitope description:ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF antigen name:Calcitonin gene-related peptide 2 host organism:Mus musculus BALB/c antibody na...

    Publication: 8913788;

  8. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641888

    Description: epitope description:NACQFQRLNAQRPDN antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  9. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641889

    Description: epitope description:QFQRLNAQRPDNRIE antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  10. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641892

    Description: epitope description:PDNRIESEGGYIETW antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  11. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641896

    Description: epitope description:ETWNPNNQEFECAGV antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  12. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641897

    Description: epitope description:NPNNQEFECAGVALS antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  13. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641898

    Description: epitope description:NQEFECAGVALSRLV antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  14. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641901

    Description: epitope description:ALSRLVLRRNALRRP antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  15. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641903

    Description: epitope description:LRRNALRRPFYSNAP antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  16. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641904

    Description: epitope description:NALRRPFYSNAPQEI antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  17. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641907

    Description: epitope description:NAPQEIFIQQGRGYF antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  18. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641917

    Description: epitope description:QQGRRHQSQRPPRRF antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  19. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641922

    Description: epitope description:QGQDQSQQQQDSHQK antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  20. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641928

    Description: epitope description:FDEGDLIAVPTGVAF antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  21. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641930

    Description: epitope description:IAVPTGVAFWMYNDH antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  22. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641939

    Description: epitope description:NNNDNQLDQFPRRFN antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  23. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641941

    Description: epitope description:LDQFPRRFNLAGNHE antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  24. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641955

    Description: epitope description:QEDREFSPRGQHGRR antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  25. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641956

    Description: epitope description:REFSPRGQHGRRERA antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  26. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641957

    Description: epitope description:SPRGQHGRRERAGQE antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  27. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641958

    Description: epitope description:GQHGRRERAGQEQEN antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  28. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641965

    Description: epitope description:SGFTPEFLAQAFQVD antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  29. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641972

    Description: epitope description:NLRGENESDEQGAIV antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  30. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641975

    Description: epitope description:EQGAIVTVRGGLRIL antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  31. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641977

    Description: epitope description:TVRGGLRILSPDRKR antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  32. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641985

    Description: epitope description:EEEYDEDEYEYDEEE antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  33. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641990

    Description: epitope description:RQQDRRRGRGSRGSG antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  34. Single chain variable fragments against beta-amyloid (Abeta) can inhibit Abeta aggregation and prevent abeta-induced neurotoxicity.

    ID: 1641304

    Description: epitope description:GAIIGLMVGGVV antigen name:Amyloid beta A4 protein host organism:Homo sapiens antibody name:C1

    Publication: 15170333;

  35. Zinc binding agonist effect on the recognition of the beta-amyloid (4-10) epitope by anti-beta-amyloid antibodies.

    ID: 1641307

    Description: epitope description:DAEFRHDSGY antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:Bam-10

    Publication: 15358179;

  36. Immune hyporesponsiveness to amyloid beta-peptide in amyloid precursor protein transgenic mice: implications for the pathogenesis and treatment of Alz...

    ID: 1641309

    Description: epitope description:DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV antigen name:Amyloid beta A4 protein host organism:Mus musculus APP

    Publication: 11517335;

  37. Species-specific immune response to immunization with human versus rodent A beta peptide.

    ID: 1641321

    Description: epitope description:DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV antigen name:Amyloid beta A4 protein host organism:Mus musculus APP

    Publication: 15312960;

  38. Surface exposed epitopes and structural heterogeneity of in vivo formed transthyretin amyloid fibrils.

    ID: 1641348

    Description: epitope description:WEPFASGKTS antigen name:Transthyretin host organism:Oryctolagus cuniculus

    Publication: 16893521;

  39. Surface exposed epitopes and structural heterogeneity of in vivo formed transthyretin amyloid fibrils.

    ID: 1641351

    Description: epitope description:WEPFASGKTS antigen name:Transthyretin host organism:Oryctolagus cuniculus

    Publication: 16893521;

  40. Assessment of the bioactivity of antibodies against beta-amyloid peptide in vitro and in vivo.

    ID: 1641365

    Description: epitope description:DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:8G7

    Publication: 16908985;

  41. Assessment of the bioactivity of antibodies against beta-amyloid peptide in vitro and in vivo.

    ID: 1641373

    Description: epitope description:DAEFRHDSGYEVHHQKL antigen name:Amyloid beta A4 protein host organism:Mus musculus

    Publication: 16908985;

  42. Assessment of the bioactivity of antibodies against beta-amyloid peptide in vitro and in vivo.

    ID: 1641379

    Description: epitope description:AIIGLMVGGVVIA antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:22C4

    Publication: 16908985;

  43. Assessment of the bioactivity of antibodies against beta-amyloid peptide in vitro and in vivo.

    ID: 1641380

    Description: epitope description:DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:8G7

    Publication: 16908985;

  44. Immunogenicity of CIGB-230, a therapeutic DNA vaccine preparation, in HCV-chronically infected individuals in a Phase I clinical trial.

    ID: 1641444

    Description: epitope description:TGTYVTGGTAARGVSQFTGLFTSGPSQKIQL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 19017255;

  45. Amino acid and phenotypic changes in dengue 2 virus associated with escape from neutralisation by IgM antibody.

    ID: 1641455

    Description: epitope description:T69 antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 11536239;

  46. Exploring the idiotypes of insulin antibodies as markers for remission in Type 1 diabetes.

    ID: 1641456

    Description: epitope description:VRGRGSK host organism:Homo sapiens

    Publication: 15569135;

  47. Exploring the idiotypes of insulin antibodies as markers for remission in Type 1 diabetes.

    ID: 1641465

    Description: epitope description:NIKSSLP host organism:Homo sapiens

    Publication: 15569135;

  48. Thermodynamic studies on the interaction of antibodies with beta-amyloid peptide.

    ID: 1641470

    Description: epitope description:RHDSGY antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:B41-N

    Publication: 17266280;

  49. Exploring the idiotypes of insulin antibodies as markers for remission in Type 1 diabetes.

    ID: 1641476

    Description: epitope description:STGERIQ host organism:Homo sapiens

    Publication: 15569135;

  50. Exploring the idiotypes of insulin antibodies as markers for remission in Type 1 diabetes.

    ID: 1641479

    Description: epitope description:LDQSRLK host organism:Homo sapiens

    Publication: 15569135;

  51. Exploring the idiotypes of insulin antibodies as markers for remission in Type 1 diabetes.

    ID: 1641480

    Description: epitope description:PGTRLQP host organism:Homo sapiens

    Publication: 15569135;

  52. Exploring the idiotypes of insulin antibodies as markers for remission in Type 1 diabetes.

    ID: 1641485

    Description: epitope description:VSRSLLD host organism:Homo sapiens

    Publication: 15569135;

  53. Gene vaccination to bias the immune response to amyloid-beta peptide as therapy for Alzheimer disease.

    ID: 1641487

    Description: epitope description:DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA antigen name:Amyloid beta A4 protein host organism:Mus musculus BALB/c

    Publication: 15596606;

  54. Exploring the idiotypes of insulin antibodies as markers for remission in Type 1 diabetes.

    ID: 1641505

    Description: epitope description:PDGSRLV host organism:Homo sapiens

    Publication: 15569135;

  55. Monoclonal antibodies against synthesized short peptides corresponding to human AA amyloid protein.

    ID: 1641535

    Description: epitope description:RSFFSFLGEAFD antigen name:Serum amyloid A-2 protein host organism:Mus musculus BALB/c

    Publication: 3661195;

  56. Immunological and conformation characterization of a phosphorylated immunodominant epitope on the paired helical filaments found in Alzheimer's diseas...

    ID: 1641544

    Description: epitope description:GAEIVYKSPVVSGD + PHOS(S8) antigen name:Microtubule-associated protein host organism:Mus musculus BALB/c antibody name:PHF-1

    Publication: 1382420;

  57. Monoclonal antibodies against synthesized short peptides corresponding to human AA amyloid protein.

    ID: 1641558

    Description: epitope description:HARGNYDAAKR antigen name:Serum amyloid A-2 protein host organism:Mus musculus BALB/c antibody name:KM-268, KM-269, KM-270

    Publication: 3661195;

  58. Monoclonal antibodies against synthesized short peptides corresponding to human AA amyloid protein.

    ID: 1641561

    Description: epitope description:HARGNYDAAKR antigen name:Serum amyloid A-2 protein host organism:Mus musculus BALB/c antibody name:KM-268, KM-269, KM-270

    Publication: 3661195;

  59. A shared idiotope among antibodies against Semliki Forest virus.

    ID: 1641573

    Description: epitope description:GREKFTIRPHYGKEI antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 7531444;

  60. A shared idiotope among antibodies against Semliki Forest virus.

    ID: 1641582

    Description: epitope description:PFVPRADEPARKGKVH antigen name:Structural polyprotein host organism:Mus musculus BALB/c antibody name:I02

    Publication: 7531444;

  61. Development and characterization of a monoclonal antibody 369.2B specific for the carboxyl-terminus of the beta A4 peptide.

    ID: 1641585

    Description: epitope description:MVGGVVIA antigen name:Amyloid beta A4 protein host organism:Mus musculus BALB/c antibody name:369.2B

    Publication: 8624111;

  62. Epitope and isotype specificities of antibodies to beta -amyloid peptide for protection against Alzheimer's disease-like neuropathology.

    ID: 1641597

    Description: epitope description:DAEFR antigen name:Amyloid beta A4 protein host organism:Mus musculus APP

    Publication: 12566568;

  63. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1641996

    Description: epitope description:EETICTASFKKNIGR antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  64. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1642000

    Description: epitope description:IGRNRSPDIYNPQAG antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  65. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1642003

    Description: epitope description:YNPQAGSLKTANELQ antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  66. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1642004

    Description: epitope description:QAGSLKTANELQLNL antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  67. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1642008

    Description: epitope description:LNLLILRWLGLSAEY antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  68. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1642016

    Description: epitope description:VPHYNTNAHSIIYAL antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  69. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1642018

    Description: epitope description:NAHSIIYALRGRAHV antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  70. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1642036

    Description: epitope description:YVAFKTDSRPSIANL antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  71. Mapping and conformational analysis of IgE-binding epitopic regions on the molecular surface of the major Ara h 3 legumin allergen of peanut (Arachis ...

    ID: 1642048

    Description: epitope description:PREQARQLKNNNPFK antigen name:Ara h 3 host organism:Homo sapiens

    Publication: 18995911;

  72. Epitope and isotype specificities of antibodies to beta -amyloid peptide for protection against Alzheimer's disease-like neuropathology.

    ID: 1642070

    Description: epitope description:RHDSGYE antigen name:Amyloid beta A4 protein host organism:Mus musculus APP

    Publication: 12566568;

  73. Epitope and isotype specificities of antibodies to beta -amyloid peptide for protection against Alzheimer's disease-like neuropathology.

    ID: 1642071

    Description: epitope description:RHDSGYE antigen name:Amyloid beta A4 protein host organism:Mus musculus APP

    Publication: 12566568;

  74. Development and characterization of monoclonal antibodies specific for amylin.

    ID: 1642076

    Description: epitope description:PPTNVGSNTY host organism:Mus musculus BALB/c antibody name:F062-4

    Publication: 8913788;

  75. Epitope and isotype specificities of antibodies to beta -amyloid peptide for protection against Alzheimer's disease-like neuropathology.

    ID: 1642078

    Description: epitope description:EFRHD antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:6C6, 10D5

    Publication: 12566568;

  76. Epitope and isotype specificities of antibodies to beta -amyloid peptide for protection against Alzheimer's disease-like neuropathology.

    ID: 1642085

    Description: epitope description:EFRHD antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:6C6, 10D5

    Publication: 12566568;

  77. Epitope and isotype specificities of antibodies to beta -amyloid peptide for protection against Alzheimer's disease-like neuropathology.

    ID: 1642087

    Description: epitope description:EFRHD antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:2C1, 12B4, 3A3, 12A11

    Publication: 12566568;

  78. Epitope and isotype specificities of antibodies to beta -amyloid peptide for protection against Alzheimer's disease-like neuropathology.

    ID: 1642109

    Description: epitope description:EFRHD antigen name:Amyloid beta A4 protein host organism:Mus musculus

    Publication: 12566568;

  79. Analysis of heterogeneous A4 peptides in human cerebrospinal fluid and blood by a newly developed sensitive Western blot assay.

    ID: 1642262

    Description: epitope description:DAEFRHDSGYEVHHQK antigen name:Amyloid beta A4 protein host organism:Mus musculus BALB/c antibody name:W0-2

    Publication: 8798471;

  80. B-cell epitopes of the allergen Chi t 1.01: peptide mapping of epitopes recognized by rabbit, murine, and human antibodies.

    ID: 1643500

    Description: epitope description:ASFDKVKG antigen name:Chi t 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 11167371;

  81. B-cell epitopes of the allergen Chi t 1.01: peptide mapping of epitopes recognized by rabbit, murine, and human antibodies.

    ID: 1643501

    Description: epitope description:SFDKVKGD antigen name:Chi t 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 11167371;

  82. B-cell epitopes of the allergen Chi t 1.01: peptide mapping of epitopes recognized by rabbit, murine, and human antibodies.

    ID: 1643503

    Description: epitope description:DKVKGDPV antigen name:Chi t 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 11167371;

  83. B-cell epitopes of the allergen Chi t 1.01: peptide mapping of epitopes recognized by rabbit, murine, and human antibodies.

    ID: 1643504

    Description: epitope description:KVKGDPVG antigen name:Chi t 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 11167371;

  84. B-cell epitopes of the allergen Chi t 1.01: peptide mapping of epitopes recognized by rabbit, murine, and human antibodies.

    ID: 1643511

    Description: epitope description:GILYAVFK antigen name:Chi t 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 11167371;

  85. B-cell epitopes of the allergen Chi t 1.01: peptide mapping of epitopes recognized by rabbit, murine, and human antibodies.

    ID: 1643514

    Description: epitope description:YAVFKADP antigen name:Chi t 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 11167371;

  86. B-cell epitopes of the allergen Chi t 1.01: peptide mapping of epitopes recognized by rabbit, murine, and human antibodies.

    ID: 1643520

    Description: epitope description:DPSIMAKF antigen name:Chi t 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 11167371;

  87. B-cell epitopes of the allergen Chi t 1.01: peptide mapping of epitopes recognized by rabbit, murine, and human antibodies.

    ID: 1643527

    Description: epitope description:FTQFAGKD antigen name:Chi t 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 11167371;

  88. B-cell epitopes of the allergen Chi t 1.01: peptide mapping of epitopes recognized by rabbit, murine, and human antibodies.

    ID: 1643529

    Description: epitope description:QFAGKDLE antigen name:Chi t 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 11167371;

  89. B-cell epitopes of the allergen Chi t 1.01: peptide mapping of epitopes recognized by rabbit, murine, and human antibodies.

    ID: 1643536

    Description: epitope description:ESIKGTAP antigen name:Chi t 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 11167371;

  90. B-cell epitopes of the allergen Chi t 1.01: peptide mapping of epitopes recognized by rabbit, murine, and human antibodies.

    ID: 1643545

    Description: epitope description:EIHANRIV antigen name:Chi t 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 11167371;

  91. B-cell epitopes of the allergen Chi t 1.01: peptide mapping of epitopes recognized by rabbit, murine, and human antibodies.

    ID: 1643547

    Description: epitope description:HANRIVGF antigen name:Chi t 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 11167371;

  92. B-cell epitopes of the allergen Chi t 1.01: peptide mapping of epitopes recognized by rabbit, murine, and human antibodies.

    ID: 1643551

    Description: epitope description:IVGFFSKI antigen name:Chi t 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 11167371;

  93. B-cell epitopes of the allergen Chi t 1.01: peptide mapping of epitopes recognized by rabbit, murine, and human antibodies.

    ID: 1643554

    Description: epitope description:FFSKIIGE antigen name:Chi t 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 11167371;

  94. B-cell epitopes of the allergen Chi t 1.01: peptide mapping of epitopes recognized by rabbit, murine, and human antibodies.

    ID: 1643556

    Description: epitope description:SKIIGELP antigen name:Chi t 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 11167371;

  95. B-cell epitopes of the allergen Chi t 1.01: peptide mapping of epitopes recognized by rabbit, murine, and human antibodies.

    ID: 1643557

    Description: epitope description:KIIGELPN antigen name:Chi t 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 11167371;

  96. B-cell epitopes of the allergen Chi t 1.01: peptide mapping of epitopes recognized by rabbit, murine, and human antibodies.

    ID: 1643562

    Description: epitope description:LPNIEADV antigen name:Chi t 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 11167371;

  97. B-cell epitopes of the allergen Chi t 1.01: peptide mapping of epitopes recognized by rabbit, murine, and human antibodies.

    ID: 1643566

    Description: epitope description:EADVNTFV antigen name:Chi t 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 11167371;

  98. B-cell epitopes of the allergen Chi t 1.01: peptide mapping of epitopes recognized by rabbit, murine, and human antibodies.

    ID: 1643568

    Description: epitope description:DVNTFVAS antigen name:Chi t 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 11167371;

  99. B-cell epitopes of the allergen Chi t 1.01: peptide mapping of epitopes recognized by rabbit, murine, and human antibodies.

    ID: 1643575

    Description: epitope description:SHKPRGVT antigen name:Chi t 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 11167371;

  100. B-cell epitopes of the allergen Chi t 1.01: peptide mapping of epitopes recognized by rabbit, murine, and human antibodies.

    ID: 1643577

    Description: epitope description:KPRGVTHD antigen name:Chi t 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 11167371;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston