Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 5 of 1,510,353 results for " "

  1. Antibody to a synthetic peptide detects a conserved region of retrovirus transmembrane proteins.

    ID: 1465980

    Description: epitope description:EVVLQNRRGLDLL antigen name:Envelope glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 3977884;

  2. Antibody to a synthetic peptide detects a conserved region of retrovirus transmembrane proteins.

    ID: 1465981

    Description: epitope description:EVVLQNRRGLDLL antigen name:Envelope glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 3977884;

  3. Localization and characterization of Sendai virus nonstructural C and C' proteins by antibodies against synthetic peptides.

    ID: 1465993

    Description: epitope description:MPSFLKKILKLRGRRQEEESRSRMLSDSSM antigen name:Protein C' host organism:Oryctolagus cuniculus antibody name:Rabbit antisera

    Publication: 3026113;

  4. Localization and characterization of Sendai virus nonstructural C and C' proteins by antibodies against synthetic peptides.

    ID: 1465995

    Description: epitope description:YVKSLSKCKTDQEVKAVMELVEEDIESLTN antigen name:Phosphoprotein host organism:Oryctolagus cuniculus antibody name:Rabbit antisera

    Publication: 3026113;

  5. Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

    ID: 1466001

    Description: epitope description:FFRSTPEDLERAEK antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

    Publication: 14645912;
Displaying 5 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston