Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Identification and assessment of new vaccine candidates for group A streptococcal infections.

    ID: 1273879

    Description: epitope description:KKTKDTKPVVKKEERQNVN antigen name:UniProt:A2RE08 host organism:Mus musculus Quackenbush

    Publication: 15246612;

  2. Identification and assessment of new vaccine candidates for group A streptococcal infections.

    ID: 1273883

    Description: epitope description:ESSVDRRPMETVSKDS antigen name:UniProt:A2RG39 host organism:Mus musculus Quackenbush

    Publication: 15246612;

  3. Proteinase K enhanced immunoreactivity of the prion protein-specific monoclonal antibody 2A11.

    ID: 1273994

    Description: epitope description:QVYYRPVDQ antigen name:Major prion protein host organism:Mus musculus 129/Ola Prp null antibody name:MAb 2A11

    Publication: 14687883;

  4. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274013

    Description: epitope description:LQGVDLLADAVAV antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  5. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274019

    Description: epitope description:NEEAGDGTTTATV antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  6. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274021

    Description: epitope description:LAVDAVIAELKKQ antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  7. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274027

    Description: epitope description:VKDGKTLNDELEI antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  8. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274028

    Description: epitope description:TLNDELEIIEGMK antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  9. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274029

    Description: epitope description:LEIIEGMKFDRGY antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  10. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274030

    Description: epitope description:GMKFDRGYISPYF antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  11. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274031

    Description: epitope description:RGYISPYFINTSK antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  12. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274034

    Description: epitope description:KCEFQDAYVLLSE antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  13. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274038

    Description: epitope description:EDVDGEALSTLVL antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  14. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274039

    Description: epitope description:NQLKDMAIATGGA antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  15. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274043

    Description: epitope description:TLNLEDVQPHDLG antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  16. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274044

    Description: epitope description:DVQPHDLGKVGEV antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  17. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274046

    Description: epitope description:GEVIVTKDDAMLL antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  18. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274047

    Description: epitope description:QIEKRIQEIIEQL antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  19. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274065

    Description: epitope description:KFGADARALMLQG antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  20. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274071

    Description: epitope description:AKSIDLKDKYKNI antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  21. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274074

    Description: epitope description:DGTTTATVLARSI antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  22. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274082

    Description: epitope description:ISDAMKKVGRKGV antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  23. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274090

    Description: epitope description:LVLNRLKVGLQVV antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  24. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274091

    Description: epitope description:LKVGLQVVAVKAP antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  25. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274099

    Description: epitope description:NERLAKLSDGVAV antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  26. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274103

    Description: epitope description:IVLGGGCALLRCI antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  27. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274106

    Description: epitope description:TLKIPAMTIAKNA antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  28. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274111

    Description: epitope description:PTKVVRTALLDAA antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  29. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274117

    Description: epitope description:KEEKDPGMGAMGG antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  30. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274125

    Description: epitope description:TVFRQMRPVSRVL antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  31. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274128

    Description: epitope description:HLTRAYAKDVKFG antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  32. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274139

    Description: epitope description:AKSIDLKDKYKNI antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  33. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274143

    Description: epitope description:DGTTTATVLARSI antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  34. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274155

    Description: epitope description:VKDGKTLNDELEI antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  35. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274156

    Description: epitope description:TLNDELEIIEGMK antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  36. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274157

    Description: epitope description:LEIIEGMKFDRGY antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  37. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274162

    Description: epitope description:SIVPALEIANAHR antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  38. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274164

    Description: epitope description:LVIIAEDVDGEAL antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  39. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274168

    Description: epitope description:NQLKDMAIATGGA antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  40. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274170

    Description: epitope description:GGAVFGEEGLTLN antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  41. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274175

    Description: epitope description:GEVIVTKDDAMLL antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  42. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274183

    Description: epitope description:NERLAKLSDGVAV antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  43. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274187

    Description: epitope description:DVEVNEKKDRVTD antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  44. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274189

    Description: epitope description:VTDALNATRAAVE antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  45. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274190

    Description: epitope description:NATRAAVEEGIVL antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  46. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274194

    Description: epitope description:PANEDQKIGIEII antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  47. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274197

    Description: epitope description:KNAGVEGSLIVEK antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  48. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274200

    Description: epitope description:QSSSEVGYDAMAG antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;

  49. Comparison of serologic assays and PCR for diagnosis of human herpesvirus 8 infection.

    ID: 1274202

    Description: epitope description:RSHLGFWQEGWSGQVYQDWLGRMNCSYENMT antigen name:Protein K8.1 host organism:Homo sapiens

    Publication: 10834972;

  50. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1274208

    Description: epitope description:RTALLDAAGVASL antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Anti...

    Publication: 12702515;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston