Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Rheumatoid-factor-reactive sites on CH2 established by analysis of overlapping peptides of primary sequence.

    ID: 1648456

    Description: epitope description:NKALPAP antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 7939417;

  2. Rheumatoid-factor-reactive sites on CH2 established by analysis of overlapping peptides of primary sequence.

    ID: 1648459

    Description: epitope description:LPAPIEK antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 7939417;

  3. Rheumatoid-factor-reactive sites on CH2 established by analysis of overlapping peptides of primary sequence.

    ID: 1648460

    Description: epitope description:PAPIEKT antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 7939417;

  4. Rheumatoid-factor-reactive sites on CH2 established by analysis of overlapping peptides of primary sequence.

    ID: 1648461

    Description: epitope description:APIEKTI antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 7939417;

  5. Rheumatoid-factor-reactive sites on CH2 established by analysis of overlapping peptides of primary sequence.

    ID: 1648470

    Description: epitope description:ISKAKGQ antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 7939417;

  6. Rheumatoid-factor-reactive sites on CH2 established by analysis of overlapping peptides of primary sequence.

    ID: 1648473

    Description: epitope description:KAKGQPR antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 7939417;

  7. Antibody epitopes probed by immunoselected phage-display library peptides in members of a family with various rheumatic manifestations.

    ID: 1648646

    Description: epitope description:ADGGAQGTA host organism:Homo sapiens

    Publication: 8978954;

  8. Antibody epitopes probed by immunoselected phage-display library peptides in members of a family with various rheumatic manifestations.

    ID: 1648655

    Description: epitope description:LSSREPQAR host organism:Homo sapiens

    Publication: 8978954;

  9. Mimotopes identified by phage display for the monoclonal antibody CII-C1 to type II collagen.

    ID: 1648810

    Description: epitope description:RAAPFGNQW host organism:Mus musculus DBA/1 antibody name:CII-C1

    Publication: 9693968;

  10. Mimotopes identified by phage display for the monoclonal antibody CII-C1 to type II collagen.

    ID: 1648814

    Description: epitope description:CESAQRPFGCC host organism:Mus musculus DBA/1 antibody name:CII-C1

    Publication: 9693968;

  11. Direct in vivo intracellular selection of conformation-sensitive antibody domains targeting Alzheimer's amyloid-beta oligomers.

    ID: 1648854

    Description: epitope description:GAIIGLMVGGVVIA antigen name:Amyloid beta A4 protein host organism:Mus musculus BALB/c antibody name:Im8, Im18

    Publication: 19361429;

  12. Direct in vivo intracellular selection of conformation-sensitive antibody domains targeting Alzheimer's amyloid-beta oligomers.

    ID: 1648856

    Description: epitope description:GAIIGLMVGGVVIA antigen name:Amyloid beta A4 protein host organism:Mus musculus BALB/c antibody name:A1, A13, A18, A19

    Publication: 19361429;

  13. Induction of arthritis in BALB/c mice by cartilage link protein: involvement of distinct regions recognized by T and B lymphocytes.

    ID: 1648883

    Description: epitope description:AKVFSRRGGNVTLPCKFYR antigen name:Hyaluronan and proteoglycan link protein 1 host organism:Mus musculus BALB/c

    Publication: 9777960;

  14. Induction of arthritis in BALB/c mice by cartilage link protein: involvement of distinct regions recognized by T and B lymphocytes.

    ID: 1648887

    Description: epitope description:DASLVITDLTLEDYGRYKCEVIEGL antigen name:Hyaluronan and proteoglycan link protein 1 host organism:Mus musculus BALB/c

    Publication: 9777960;

  15. Induction of arthritis in BALB/c mice by cartilage link protein: involvement of distinct regions recognized by T and B lymphocytes.

    ID: 1648895

    Description: epitope description:NDGAQIAKVGQIFAAWKLLGYDRCD antigen name:Hyaluronan and proteoglycan link protein 1 host organism:Mus musculus BALB/c

    Publication: 9777960;

  16. Induction of arthritis in BALB/c mice by cartilage link protein: involvement of distinct regions recognized by T and B lymphocytes.

    ID: 1648897

    Description: epitope description:PRRRCSPSEAAVRFVGFPDKKHKLY antigen name:Hyaluronan and proteoglycan link protein 1 host organism:Mus musculus BALB/c

    Publication: 9777960;

  17. Establishment by the rat lymph node method of epitope-defined monoclonal antibodies recognizing the six different alpha chains of human type IV collag...

    ID: 1648902

    Description: epitope description:SKPQSETL antigen name:Collagen alpha-5(IV) chain host organism:Rattus norvegicus antibody name:H52

    Publication: 8548560;

  18. Establishment by the rat lymph node method of epitope-defined monoclonal antibodies recognizing the six different alpha chains of human type IV collag...

    ID: 1648906

    Description: epitope description:KKPTPSTL antigen name:Collagen alpha-1(IV) chain host organism:Rattus norvegicus antibody name:H11

    Publication: 8548560;

  19. Identification of an immunodominant B-cell epitope in bovine type II collagen and the production of antibodies to type II collagen by immunization wit...

    ID: 1647607

    Description: epitope description:PAGGPGFPG antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1283603;

  20. Identification of peptide motifs recognized by a human IgG autoanti-IgE antibody using a phage display library.

    ID: 1648015

    Description: epitope description:GGRHPSPMGTFDTQT host organism:Homo sapiens

    Publication: 10848928;

  21. T-cell epitope of alpha3 chain of type IV collagen induces severe glomerulonephritis.

    ID: 1648142

    Description: epitope description:MRGFIFTRHSQTT antigen name:Protein LOC100911572 host organism:Rattus norvegicus Wistar

    Publication: 12969147;

  22. Epitope mapping of anti-glomerular basement membrane (GBM) antibodies with synthetic peptides.

    ID: 1648144

    Description: epitope description:PGSCLEEFRSAPFIECHGRG antigen name:Collagen alpha-1(IV) chain host organism:Homo sapiens

    Publication: 8809141;

  23. Epitope mapping of anti-glomerular basement membrane (GBM) antibodies with synthetic peptides.

    ID: 1648146

    Description: epitope description:FWLATIERSEMFKKPTPSTL antigen name:Collagen alpha-1(IV) chain host organism:Homo sapiens

    Publication: 8809141;

  24. Epitope mapping and topographic analysis of VAR2CSA DBL3X involved in P. falciparum placental sequestration.

    ID: 1648281

    Description: epitope description:KETELLYEYHDTGTAIISKN antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I639) host organism:Homo sapiens

    Publication: 17112315;

  25. Extracellular neurofibrillary tangles are immunopositive for the 40 carboxy-terminal sequence of beta-amyloid protein.

    ID: 1648284

    Description: epitope description:GVVIA antigen name:Amyloid beta A4 protein host organism:Oryctolagus cuniculus antibody name:B42

    Publication: 9862635;

  26. Extracellular neurofibrillary tangles are immunopositive for the 40 carboxy-terminal sequence of beta-amyloid protein.

    ID: 1648288

    Description: epitope description:GSNKGAIIGLM antigen name:Amyloid beta A4 protein host organism:Oryctolagus cuniculus antibody name:B-mid

    Publication: 9862635;

  27. Repeated helical epitopes of defined amino acid sequence in human type III collagen identified by monoclonal antibodies.

    ID: 1648292

    Description: epitope description:GAPGLRGGAG + HYL(P3) antigen name:Collagen alpha-1(III) chain host organism:Mus musculus A.SW/SN antibody name:1F8

    Publication: 1376414;

  28. Detection of collagenase-induced damage of collagen by 9A4, a monoclonal C-terminal neoepitope antibody.

    ID: 1648301

    Description: epitope description:GPPGPQG antigen name:Collagen alpha-1(II) chain host organism:Mus musculus BALB/c antibody name:9A4

    Publication: 10517180;

  29. Novel monoclonal antibodies against proteolipid protein peptide 139-151 demonstrate demyelination and myelin uptake by macrophages in MS and marmoset ...

    ID: 1648352

    Description: epitope description:HCLGKWLGHPDKF antigen name:Myelin proteolipid protein host organism:Mus musculus SJL antibody name:J1-03

    Publication: 11525809;

  30. Rheumatoid-factor-reactive sites on CH2 established by analysis of overlapping peptides of primary sequence.

    ID: 1648361

    Description: epitope description:FLFPPKP antigen name:Immunoglobulin host organism:Homo sapiens antibody name:RF113

    Publication: 7939417;

  31. Rheumatoid-factor-reactive sites on CH2 established by analysis of overlapping peptides of primary sequence.

    ID: 1648368

    Description: epitope description:PKDTLMI antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 7939417;

  32. Rheumatoid-factor-reactive sites on CH2 established by analysis of overlapping peptides of primary sequence.

    ID: 1648375

    Description: epitope description:SRTPEVT antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 7939417;

  33. Rheumatoid-factor-reactive sites on CH2 established by analysis of overlapping peptides of primary sequence.

    ID: 1648379

    Description: epitope description:EVTCVVV antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 7939417;

  34. Rheumatoid-factor-reactive sites on CH2 established by analysis of overlapping peptides of primary sequence.

    ID: 1648383

    Description: epitope description:VVVDVSH antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 7939417;

  35. Rheumatoid-factor-reactive sites on CH2 established by analysis of overlapping peptides of primary sequence.

    ID: 1648384

    Description: epitope description:VVDVSHE antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 7939417;

  36. Rheumatoid-factor-reactive sites on CH2 established by analysis of overlapping peptides of primary sequence.

    ID: 1648391

    Description: epitope description:EDPQVKF antigen name:Other Homo sapiens (human) protein host organism:Homo sapiens

    Publication: 7939417;

  37. Rheumatoid-factor-reactive sites on CH2 established by analysis of overlapping peptides of primary sequence.

    ID: 1648392

    Description: epitope description:DPQVKFN antigen name:Other Homo sapiens (human) protein host organism:Homo sapiens

    Publication: 7939417;

  38. Rheumatoid-factor-reactive sites on CH2 established by analysis of overlapping peptides of primary sequence.

    ID: 1648397

    Description: epitope description:KFNWYVD antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 7939417;

  39. Rheumatoid-factor-reactive sites on CH2 established by analysis of overlapping peptides of primary sequence.

    ID: 1648404

    Description: epitope description:DGVQVHN antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 7939417;

  40. Rheumatoid-factor-reactive sites on CH2 established by analysis of overlapping peptides of primary sequence.

    ID: 1648412

    Description: epitope description:KTKPREQ antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 7939417;

  41. Establishment by the rat lymph node method of epitope-defined monoclonal antibodies recognizing the six different alpha chains of human type IV collag...

    ID: 1648910

    Description: epitope description:ERMFRK antigen name:Collagen alpha-3(IV) chain host organism:Rattus norvegicus antibody name:h32

    Publication: 8548560;

  42. Establishment by the rat lymph node method of epitope-defined monoclonal antibodies recognizing the six different alpha chains of human type IV collag...

    ID: 1648912

    Description: epitope description:FSSAP antigen name:Collagen alpha-4(IV) chain host organism:Rattus norvegicus antibody name:H44

    Publication: 8548560;

  43. X-ray structure of the PHF core C-terminus: insight into the folding of the intrinsically disordered protein tau in Alzheimer's disease.

    ID: 1648933

    Description: epitope description:TDHGAE antigen name:Other Homo sapiens (human) protein host organism:Mus musculus C3H antibody name:MN423

    Publication: 18061582;

  44. Epitope-specific recognition of type II collagen by rheumatoid arthritis antibodies is shared with recognition by antibodies that are arthritogenic in...

    ID: 1648942

    Description: epitope description:ERGLKGHRGFT antigen name:Collagen alpha-1(II) chain host organism:Homo sapiens

    Publication: 12355481;

  45. Epitope-specific recognition of type II collagen by rheumatoid arthritis antibodies is shared with recognition by antibodies that are arthritogenic in...

    ID: 1648945

    Description: epitope description:MPGERGAAGIAGPK antigen name:Collagen alpha-1(II) chain host organism:Homo sapiens

    Publication: 12355481;

  46. Epitope-specific recognition of type II collagen by rheumatoid arthritis antibodies is shared with recognition by antibodies that are arthritogenic in...

    ID: 1648951

    Description: epitope description:ARGLTGRPGDA antigen name:Collagen alpha-1(II) chain host organism:Homo sapiens

    Publication: 12355481;

  47. Endogenous C-terminal fragments of beta-amyloid precursor protein from Xenopus laevis skin exudate.

    ID: 1648957

    Description: epitope description:DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV antigen name:Amyloid beta A4 protein host organism:Mus musculus

    Publication: 17270477;

  48. A rheumatoid factor specific mimotope identified by a peptide display library.

    ID: 1648963

    Description: epitope description:SLITAARGAPS host organism:Homo sapiens antibody name:B'20

    Publication: 10520896;

  49. A rheumatoid factor specific mimotope identified by a peptide display library.

    ID: 1648993

    Description: epitope description:LLPWLDGHPM host organism:Homo sapiens antibody name:B'20

    Publication: 10520896;

  50. Epitopes on the CB-11 peptide of type II collagen recognized by antibodies from patients with rheumatoid arthritis.

    ID: 1649060

    Description: epitope description:DAGPQGKVGPS antigen name:Collagen alpha-1(II) chain host organism:Homo sapiens

    Publication: 7688639;

  51. Epitopes on the CB-11 peptide of type II collagen recognized by antibodies from patients with rheumatoid arthritis.

    ID: 1649062

    Description: epitope description:QGKVGPSGAPG antigen name:Collagen alpha-1(II) chain host organism:Homo sapiens

    Publication: 7688639;

  52. Variable region gene selection of immunoglobulin G-expressing B cells with specificity for a defined epitope on type II collagen.

    ID: 1649130

    Description: epitope description:GFAGQAGPAGATGAPGRP antigen name:Collagen alpha-1(II) chain host organism:Mus musculus DBA/1 antibody name:CB313, CB300, CB20, CB34...

    Publication: 7691608;

  53. The goodpasture autoantigen. Identification of multiple cryptic epitopes on the NC1 domain of the alpha3(IV) collagen chain.

    ID: 1649132

    Description: epitope description:TDIPPCPHGWISLWK antigen name:Collagen alpha-3(IV) chain host organism:Homo sapiens antibody name:GPB

    Publication: 10681598;

  54. The goodpasture autoantigen. Identification of multiple cryptic epitopes on the NC1 domain of the alpha3(IV) collagen chain.

    ID: 1649133

    Description: epitope description:TDIPPCPHGWISLWK antigen name:Collagen alpha-3(IV) chain host organism:Homo sapiens antibody name:GPB

    Publication: 10681598;

  55. The goodpasture autoantigen. Identification of multiple cryptic epitopes on the NC1 domain of the alpha3(IV) collagen chain.

    ID: 1649141

    Description: epitope description:LMPMNMAPITGRALE antigen name:Collagen alpha-3(IV) chain host organism:Mus musculus antibody name:MAb #175

    Publication: 10681598;

  56. Structural characterization of peptides that bind synovial fluid antibodies from RA patients: a novel strategy for identification of disease-related e...

    ID: 1649158

    Description: epitope description:RGGIRRQSL host organism:Homo sapiens

    Publication: 7533685;

  57. Structural characterization of peptides that bind synovial fluid antibodies from RA patients: a novel strategy for identification of disease-related e...

    ID: 1649160

    Description: epitope description:ADASVPVMP host organism:Homo sapiens

    Publication: 7533685;

  58. Structural characterization of peptides that bind synovial fluid antibodies from RA patients: a novel strategy for identification of disease-related e...

    ID: 1649165

    Description: epitope description:GRTPEDNTL host organism:Homo sapiens

    Publication: 7533685;

  59. Structural characterization of peptides that bind synovial fluid antibodies from RA patients: a novel strategy for identification of disease-related e...

    ID: 1649169

    Description: epitope description:ATADYPQKS host organism:Homo sapiens

    Publication: 7533685;

  60. Structural characterization of peptides that bind synovial fluid antibodies from RA patients: a novel strategy for identification of disease-related e...

    ID: 1649170

    Description: epitope description:RPPHSASWR host organism:Homo sapiens

    Publication: 7533685;

  61. Structural characterization of peptides that bind synovial fluid antibodies from RA patients: a novel strategy for identification of disease-related e...

    ID: 1649173

    Description: epitope description:IRYHTNWSS host organism:Homo sapiens

    Publication: 7533685;

  62. Structural characterization of peptides that bind synovial fluid antibodies from RA patients: a novel strategy for identification of disease-related e...

    ID: 1649177

    Description: epitope description:APSSLAGNG host organism:Homo sapiens

    Publication: 7533685;

  63. Structural characterization of peptides that bind synovial fluid antibodies from RA patients: a novel strategy for identification of disease-related e...

    ID: 1649189

    Description: epitope description:LNTAKHRES host organism:Homo sapiens

    Publication: 7533685;

  64. Structural characterization of peptides that bind synovial fluid antibodies from RA patients: a novel strategy for identification of disease-related e...

    ID: 1649191

    Description: epitope description:TPDSLGRPS host organism:Homo sapiens

    Publication: 7533685;

  65. Structural characterization of peptides that bind synovial fluid antibodies from RA patients: a novel strategy for identification of disease-related e...

    ID: 1649199

    Description: epitope description:LLRPVARDT host organism:Homo sapiens

    Publication: 7533685;

  66. Structural characterization of peptides that bind synovial fluid antibodies from RA patients: a novel strategy for identification of disease-related e...

    ID: 1649205

    Description: epitope description:YTLQKAVLS host organism:Homo sapiens

    Publication: 7533685;

  67. Structural characterization of peptides that bind synovial fluid antibodies from RA patients: a novel strategy for identification of disease-related e...

    ID: 1649210

    Description: epitope description:PQSPGSSFP host organism:Homo sapiens

    Publication: 7533685;

  68. T-cell receptors of man and mouse studied with antibodies against synthetic peptides.

    ID: 1649332

    Description: epitope description:ANYGYTFGSGTRLTVV antigen name:T-cell receptor host organism:Oryctolagus cuniculus

    Publication: 1489555;

  69. T-cell receptors of man and mouse studied with antibodies against synthetic peptides.

    ID: 1649334

    Description: epitope description:ANYGYTFGSGTRLTVV antigen name:T-cell receptor host organism:Oryctolagus cuniculus

    Publication: 1489555;

  70. T-cell receptors of man and mouse studied with antibodies against synthetic peptides.

    ID: 1649335

    Description: epitope description:ANYGYTFGSGTRLTVV antigen name:T-cell receptor host organism:Oryctolagus cuniculus

    Publication: 1489555;

  71. T-cell receptors of man and mouse studied with antibodies against synthetic peptides.

    ID: 1649349

    Description: epitope description:ANYGYTFGSGTRLTVV antigen name:T-cell receptor host organism:Oryctolagus cuniculus

    Publication: 1489555;

  72. The natural human IgG anti-F(ab')2 antibody recognizes a conformational IgG1 hinge epitope.

    ID: 1649359

    Description: epitope description:TCPPCPAPELLGG antigen name:Immunoglobulin host organism:Homo sapiens

    Publication: 7539020;

  73. HSP-derived peptides inducing uveitis and IgG and IgA antibodies.

    ID: 1649372

    Description: epitope description:NPLGLKRGIEKAVEK antigen name:60 kDa chaperonin 2 host organism:Rattus norvegicus Lewis

    Publication: 9990336;

  74. T-cell receptors of man and mouse studied with antibodies against synthetic peptides.

    ID: 1649377

    Description: epitope description:TLVCLATGFFPDHVEL antigen name:T-cell receptor host organism:Oryctolagus cuniculus

    Publication: 1489555;

  75. T-cell receptors of man and mouse studied with antibodies against synthetic peptides.

    ID: 1649390

    Description: epitope description:TLVCLATGFFPDHVEL antigen name:T-cell receptor host organism:Oryctolagus cuniculus

    Publication: 1489555;

  76. HSP-derived peptides inducing uveitis and IgG and IgA antibodies.

    ID: 1649419

    Description: epitope description:DLSLLGKARKVVVTKD antigen name:60 kDa chaperonin 2 host organism:Rattus norvegicus Lewis

    Publication: 9990336;

  77. HSP-derived peptides inducing uveitis and IgG and IgA antibodies.

    ID: 1649420

    Description: epitope description:ATVLAQALVREGLRN antigen name:60 kDa chaperonin 2 host organism:Rattus norvegicus Lewis

    Publication: 9990336;

  78. HSP-derived peptides inducing uveitis and IgG and IgA antibodies.

    ID: 1649424

    Description: epitope description:QPHDLGKVGEVIVTKD antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Rattus norvegicus Lewis

    Publication: 9990336;

  79. Citrullinated fibrinogen detected as a soluble citrullinated autoantigen in rheumatoid arthritis synovial fluids.

    ID: 1649438

    Description: epitope description:GNEITRGGSTS + CITR(R6) antigen name:Fibrinogen alpha chain host organism:Mus musculus BALB/c antibody name:cF252.1

    Publication: 16449316;

  80. Human autoantibodies to a synthetic putative T cell receptor beta-chain regulatory idiotype: expression in autoimmunity and aging.

    ID: 1649439

    Description: epitope description:VTEMGQEVTLRCKPIS antigen name:T-cell receptor host organism:Homo sapiens

    Publication: 8398197;

  81. Human autoantibodies to a synthetic putative T cell receptor beta-chain regulatory idiotype: expression in autoimmunity and aging.

    ID: 1649445

    Description: epitope description:WYRQTMMRGLELLIYF antigen name:T-cell receptor host organism:Homo sapiens

    Publication: 8398197;

  82. Human autoantibodies to a synthetic putative T cell receptor beta-chain regulatory idiotype: expression in autoimmunity and aging.

    ID: 1649450

    Description: epitope description:LLIYFNNNVPIDDSGM antigen name:T-cell receptor host organism:Homo sapiens

    Publication: 8398197;

  83. Human autoantibodies to a synthetic putative T cell receptor beta-chain regulatory idiotype: expression in autoimmunity and aging.

    ID: 1649451

    Description: epitope description:DDSGMPEDRFSAKMPN antigen name:T-cell receptor host organism:Homo sapiens

    Publication: 8398197;

  84. Human autoantibodies to a synthetic putative T cell receptor beta-chain regulatory idiotype: expression in autoimmunity and aging.

    ID: 1649452

    Description: epitope description:DDSGMPEDRFSAKMPN antigen name:T-cell receptor host organism:Homo sapiens

    Publication: 8398197;

  85. Human autoantibodies to a synthetic putative T cell receptor beta-chain regulatory idiotype: expression in autoimmunity and aging.

    ID: 1649457

    Description: epitope description:KIQPSEPRDSAVYFCA antigen name:T-cell receptor host organism:Homo sapiens

    Publication: 8398197;

  86. Human autoantibodies to a synthetic putative T cell receptor beta-chain regulatory idiotype: expression in autoimmunity and aging.

    ID: 1649460

    Description: epitope description:VYFCASSFSTCSANYG antigen name:T-cell receptor host organism:Homo sapiens

    Publication: 8398197;

  87. Human autoantibodies to a synthetic putative T cell receptor beta-chain regulatory idiotype: expression in autoimmunity and aging.

    ID: 1649463

    Description: epitope description:SANYGYTFGSGTRLTV antigen name:T-cell receptor host organism:Homo sapiens

    Publication: 8398197;

  88. Human autoantibodies to a synthetic putative T cell receptor beta-chain regulatory idiotype: expression in autoimmunity and aging.

    ID: 1649464

    Description: epitope description:SANYGYTFGSGTRLTV antigen name:T-cell receptor host organism:Homo sapiens

    Publication: 8398197;

  89. Human autoantibodies to a synthetic putative T cell receptor beta-chain regulatory idiotype: expression in autoimmunity and aging.

    ID: 1649467

    Description: epitope description:TRLTVVEDLNKVFPPE antigen name:T-cell receptor host organism:Homo sapiens

    Publication: 8398197;

  90. Human autoantibodies to a synthetic putative T cell receptor beta-chain regulatory idiotype: expression in autoimmunity and aging.

    ID: 1649472

    Description: epitope description:SEAEISHTQKATLVCL antigen name:T-cell receptor host organism:Homo sapiens

    Publication: 8398197;

  91. Human autoantibodies to a synthetic putative T cell receptor beta-chain regulatory idiotype: expression in autoimmunity and aging.

    ID: 1649482

    Description: epitope description:KEVHSGVSTDPQPLKE antigen name:T-cell receptor host organism:Homo sapiens

    Publication: 8398197;

  92. Human autoantibodies to a synthetic putative T cell receptor beta-chain regulatory idiotype: expression in autoimmunity and aging.

    ID: 1649485

    Description: epitope description:QPLKEQPALNDSRYCL antigen name:T-cell receptor host organism:Homo sapiens

    Publication: 8398197;

  93. Identification of the pentapeptide constituting a dominant epitope common to all eukaryotic heat shock protein 90 molecular chaperones.

    ID: 1649505

    Description: epitope description:GGVSAESLDHAW host organism:Mus musculus antibody name:K41102

    Publication: 16333984;

  94. Identification of the pentapeptide constituting a dominant epitope common to all eukaryotic heat shock protein 90 molecular chaperones.

    ID: 1649510

    Description: epitope description:RPLGLQEESLDG host organism:Mus musculus antibody name:K41320

    Publication: 16333984;

  95. Identification of the pentapeptide constituting a dominant epitope common to all eukaryotic heat shock protein 90 molecular chaperones.

    ID: 1649522

    Description: epitope description:YMRFNTPIWAST host organism:Mus musculus antibody name:K41331

    Publication: 16333984;

  96. Identification of the pentapeptide constituting a dominant epitope common to all eukaryotic heat shock protein 90 molecular chaperones.

    ID: 1649527

    Description: epitope description:GRGGAIWDRPEF host organism:Mus musculus antibody name:K41338

    Publication: 16333984;

  97. Identification of the pentapeptide constituting a dominant epitope common to all eukaryotic heat shock protein 90 molecular chaperones.

    ID: 1649533

    Description: epitope description:EVAESDDEAEVY host organism:Mus musculus antibody name:K3729

    Publication: 16333984;

  98. Identification of the pentapeptide constituting a dominant epitope common to all eukaryotic heat shock protein 90 molecular chaperones.

    ID: 1649543

    Description: epitope description:RRDSGGFEQIWG host organism:Mus musculus antibody name:K41218

    Publication: 16333984;

  99. Identification of the pentapeptide constituting a dominant epitope common to all eukaryotic heat shock protein 90 molecular chaperones.

    ID: 1649545

    Description: epitope description:DRGEGPRINARC host organism:Mus musculus antibody name:K41002

    Publication: 16333984;

  100. Marked differences in fine specificity and isotype usage of the anti-citrullinated protein antibody in health and disease.

    ID: 1649582

    Description: epitope description:STRSVSSSSYRRMFGG + CITR(R3, R11, R12) antigen name:Vimentin host organism:Homo sapiens

    Publication: 18821680;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston