Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Neutralizing epitope mapping of six beta1-bungarotoxin monoclonal antibodies and its application in beta1-bungarotoxin peptide vaccine design.

    ID: 1482989

    Description: epitope description:YVHDNC antigen name:Basic phospholipase A2 beta-bungarotoxin A1 chain host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 9461548;

  2. Neutralizing epitope mapping of six beta1-bungarotoxin monoclonal antibodies and its application in beta1-bungarotoxin peptide vaccine design.

    ID: 1482991

    Description: epitope description:CFGNSEY antigen name:Basic phospholipase A2 beta-bungarotoxin A1 chain host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 9461548;

  3. Antigenic sites of coxsackie A9 virus inducing neutralizing monoclonal antibodies protective in mice.

    ID: 1483019

    Description: epitope description:E223, K234 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:K1, K4, K6, K8, K9, K10, K11, K13, K14,...

    Publication: 12890622;

  4. Antigenic sites of coxsackie A9 virus inducing neutralizing monoclonal antibodies protective in mice.

    ID: 1483024

    Description: epitope description:MSTLNTHGAF antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 12890622;

  5. Antigenic sites of coxsackie A9 virus inducing neutralizing monoclonal antibodies protective in mice.

    ID: 1483026

    Description: epitope description:TDTRKDINTVTTVAQS antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 12890622;

  6. Antigenic sites of coxsackie A9 virus inducing neutralizing monoclonal antibodies protective in mice.

    ID: 1483032

    Description: epitope description:E223, K234 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:K8

    Publication: 12890622;

  7. Peptide mimotopes as prototypic templates of broad-spectrum surrogates of carbohydrate antigens.

    ID: 1483034

    Description: epitope description:GGIYYPYDIYYPYDIYYPYD host organism:Mus musculus

    Publication: 12887105;

  8. Peptide mimotopes as prototypic templates of broad-spectrum surrogates of carbohydrate antigens.

    ID: 1483037

    Description: epitope description:GGIYYPYDIYYPYDIYYPYD host organism:Mus musculus BALB/c

    Publication: 12887105;

  9. Peptide mimotopes as prototypic templates of broad-spectrum surrogates of carbohydrate antigens.

    ID: 1483038

    Description: epitope description:GGIYYPYDIYYPYDIYYPYD host organism:Mus musculus BALB/c

    Publication: 12887105;

  10. Peptide mimotopes as prototypic templates of broad-spectrum surrogates of carbohydrate antigens.

    ID: 1483041

    Description: epitope description:GGIYYPYDIYYPYDIYYPYD host organism:Mus musculus BALB/c

    Publication: 12887105;

  11. A peptide mimic of a protective epitope of respiratory syncytial virus selected from a combinatorial library induces virus-neutralizing antibodies and...

    ID: 1483083

    Description: epitope description:HWYISKPQ host organism:Mus musculus BALB/c antibody name:MAb 19

    Publication: 9499058;

  12. A peptide mimic of a protective epitope of respiratory syncytial virus selected from a combinatorial library induces virus-neutralizing antibodies and...

    ID: 1483096

    Description: epitope description:HPYISKPQ host organism:Mus musculus BALB/c

    Publication: 9499058;

  13. A peptide mimic of a protective epitope of respiratory syncytial virus selected from a combinatorial library induces virus-neutralizing antibodies and...

    ID: 1483097

    Description: epitope description:HWSISKPQ host organism:Mus musculus BALB/c

    Publication: 9499058;

  14. Ability of linear and cyclic peptides of neutralization antigenic site 1 of poliovirus type 1 to induce virus cross-reactive and neutralizing antibodi...

    ID: 1483098

    Description: epitope description:CDNPASTTNKDKDNPASTTNKDKDNPASTTNKDK host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7535942;

  15. Ability of linear and cyclic peptides of neutralization antigenic site 1 of poliovirus type 1 to induce virus cross-reactive and neutralizing antibodi...

    ID: 1483107

    Description: epitope description:ARGACVTIMTVDNPASTTNKDKLFAVWKITYKDTV antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7535942;

  16. A peptide mimic of a protective epitope of respiratory syncytial virus selected from a combinatorial library induces virus-neutralizing antibodies and...

    ID: 1483135

    Description: epitope description:HPYISKPQ host organism:Mus musculus BALB/c antibody name:MAb 19

    Publication: 9499058;

  17. A peptide mimic of a protective epitope of respiratory syncytial virus selected from a combinatorial library induces virus-neutralizing antibodies and...

    ID: 1483139

    Description: epitope description:HWSISKPQ host organism:Mus musculus BALB/c

    Publication: 9499058;

  18. The HTLV-I orfI protein is recognized by serum antibodies from naturally infected humans and experimentally infected rabbits.

    ID: 1483184

    Description: epitope description:PSDVSGLLLRPPPAP antigen name:Accessory protein p12I host organism:Oryctolagus cuniculus

    Publication: 10936091;

  19. The HTLV-I orfI protein is recognized by serum antibodies from naturally infected humans and experimentally infected rabbits.

    ID: 1483186

    Description: epitope description:SPSLPITMRFPARWRF antigen name:Accessory protein p12I host organism:Oryctolagus cuniculus

    Publication: 10936091;

  20. The HTLV-I orfI protein is recognized by serum antibodies from naturally infected humans and experimentally infected rabbits.

    ID: 1483187

    Description: epitope description:LPWRAPSQPAAAFLF antigen name:Accessory protein p12I host organism:Oryctolagus cuniculus

    Publication: 10936091;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston