Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Preparation and characterization of antibodies against mouse prion protein (PrP) peptides.

    ID: 1276422

    Description: epitope description:RENMYRYPNQ antigen name:Major prion protein host organism:Oryctolagus cuniculus antibody name:Ab150-159

    Publication: 7535178;

  2. Preparation and characterization of antibodies against mouse prion protein (PrP) peptides.

    ID: 1276423

    Description: epitope description:RENMYRYPNQ antigen name:Major prion protein host organism:Oryctolagus cuniculus antibody name:Ab150-159

    Publication: 7535178;

  3. Preparation and characterization of antibodies against mouse prion protein (PrP) peptides.

    ID: 1276431

    Description: epitope description:CVTQYQKESQAYYD antigen name:Major prion protein host organism:Oryctolagus cuniculus antibody name:Ab213-226

    Publication: 7535178;

  4. Mapping of protective and cross-reactive domains of the type A neurotoxin of Clostridium botulinum.

    ID: 1276439

    Description: epitope description:EIIWTLQDTQEIKQRVVFKYSQMINISDYINRWIFVTITNNRLNNSKIYINGRLIDQKPISNLGNIHASNNIMFKLDGCRDTHRYIWIKYFNLFDKELNEKEIKDLYDNQSNSGILKDFWGDYLQYDKPY...

    Publication: 9014296;

  5. Mapping of protective and cross-reactive domains of the type A neurotoxin of Clostridium botulinum.

    ID: 1276440

    Description: epitope description:EIIWTLQDTQEIKQRVVFKYSQMINISDYINRWIFVTITNNRLNNSKIYINGRLIDQKPISNLGNIHASNNIMFKLDGCRDTHRYIWIKYFNLFDKELNEKEIKDLYDNQSNSGILKDFWGDYLQYDKPY...

    Publication: 9014296;

  6. Mapping of protective and cross-reactive domains of the type A neurotoxin of Clostridium botulinum.

    ID: 1276445

    Description: epitope description:LNSSLYRGTKFIIKKYASGNKDNIVRNNDRVYINVVVKNKEYRLATNASQAGVEKILSALEIPDVGNLSQVVVMKSKNDQGITNKCKMNLQDNNGNDIGFIGFHQFNNIAKLVASNWYNRQIERSSRTLG...

    Publication: 9014296;

  7. Definition of Brucella A and M epitopes by monoclonal typing reagents and synthetic oligosaccharides.

    ID: 1269754

    Description: epitope description:alpha-D-Rhap4NFo-(1->3)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-yl group antigen ...

    Publication: 2474505;

  8. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1269929

    Description: epitope description:YLTETKIDKL antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  9. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1269935

    Description: epitope description:IDKLCVWNNK antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  10. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1269972

    Description: epitope description:QSITELCSEY antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  11. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1269973

    Description: epitope description:SITELCSEYR antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  12. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1269976

    Description: epitope description:ELCSEYRNTQ antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  13. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1269979

    Description: epitope description:SEYRNTQIYT antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  14. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1269990

    Description: epitope description:YTINDKILSY antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  15. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270004

    Description: epitope description:ILSYTESMAG antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  16. Definition of Brucella A and M epitopes by monoclonal typing reagents and synthetic oligosaccharides.

    ID: 1269755

    Description: epitope description:alpha-D-Rhap4NFo-(1->3)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-yl group antigen ...

    Publication: 2474505;

  17. Definition of Brucella A and M epitopes by monoclonal typing reagents and synthetic oligosaccharides.

    ID: 1269757

    Description: epitope description:alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo(1->3)-alpha-D-Rhap4NFo-yl group antigen name:lipopolysaccharide host organism:Mus musculu...

    Publication: 2474505;

  18. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1269783

    Description: epitope description:VPGSQHIDSQ antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  19. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1269873

    Description: epitope description:QKKAIERMKD antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  20. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1269880

    Description: epitope description:DTLRITYLTE antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  21. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1269883

    Description: epitope description:TLRITYLTET antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  22. Definition of Brucella A and M epitopes by monoclonal typing reagents and synthetic oligosaccharides.

    ID: 1269911

    Description: epitope description:alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-(1->2)-alpha-D-Rhap4NFo-yl group antigen ...

    Publication: 2474505;

  23. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270015

    Description: epitope description:REMVIITFKS antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  24. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270021

    Description: epitope description:TFKSGATFQV antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  25. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270029

    Description: epitope description:QVEVPGSQHI antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  26. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270238

    Description: epitope description:VPGSQHIDSQ antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  27. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270242

    Description: epitope description:QHIDSQKKAI antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  28. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270247

    Description: epitope description:QKKAIERMKD antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  29. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270255

    Description: epitope description:KDTLRITYLT antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  30. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270257

    Description: epitope description:TLRITYLTET antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  31. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270261

    Description: epitope description:TYLTETKIDK antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  32. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270262

    Description: epitope description:YLTETKIDKL antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  33. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270277

    Description: epitope description:PNSIAAISME antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  34. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270278

    Description: epitope description:NSIAAISMEE antigen name:Other Escherichia coli protein host organism:Mus musculus BALB/c

    Publication: 8606092;

  35. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270284

    Description: epitope description:APQSITELCS antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  36. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270380

    Description: epitope description:QSITELCSEY antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  37. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270381

    Description: epitope description:SITELCSEYR antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  38. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270383

    Description: epitope description:TELCSEYRNT antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  39. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270384

    Description: epitope description:ELCSEYRNTQ antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  40. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270389

    Description: epitope description:QSITELCSEY antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  41. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270397

    Description: epitope description:EYRNTQIYTI antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  42. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270399

    Description: epitope description:RNTQIYTIND antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  43. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270400

    Description: epitope description:NTQIYTINDK antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  44. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270411

    Description: epitope description:TQIYTINDKI antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  45. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270413

    Description: epitope description:IYTINDKILS antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  46. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270419

    Description: epitope description:KILSYTESMA antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  47. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270426

    Description: epitope description:SMAGKREMVI antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  48. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270427

    Description: epitope description:NDKILSYTES antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  49. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270440

    Description: epitope description:KREMVIITFK antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;

  50. Epitope maps of the Escherichia coli heat-labile toxin B subunit for development of a synthetic oral vaccine.

    ID: 1270441

    Description: epitope description:REMVIITFKS antigen name:Heat-labile enterotoxin B chain host organism:Mus musculus BALB/c

    Publication: 8606092;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston