Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. The HTLV-I orfI protein is recognized by serum antibodies from naturally infected humans and experimentally infected rabbits.

    ID: 1483188

    Description: epitope description:FLPWKAPSQP antigen name:Accessory protein p12I host organism:Oryctolagus cuniculus

    Publication: 10936091;

  2. The HTLV-I orfI protein is recognized by serum antibodies from naturally infected humans and experimentally infected rabbits.

    ID: 1483189

    Description: epitope description:FLPWRAPSQP antigen name:Accessory protein p12I host organism:Oryctolagus cuniculus

    Publication: 10936091;

  3. Critical role of neighbouring sequences on the immunogenicity of the C3 poliovirus neutralization epitope expressed at the surface of recombinant bact...

    ID: 1483228

    Description: epitope description:DNPASTTNKDK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1694613;

  4. Critical role of neighbouring sequences on the immunogenicity of the C3 poliovirus neutralization epitope expressed at the surface of recombinant bact...

    ID: 1483232

    Description: epitope description:CVTIMTVDNPASTTNKDKLFAVWKITYKDT antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1694613;

  5. Use of synthetic peptides to locate neutralizing antigenic domains on the fusion protein of respiratory syncytial virus.

    ID: 1483264

    Description: epitope description:SLINDMPITNDQKKLMSNNV antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus

    Publication: 2033389;

  6. Use of synthetic peptides to locate neutralizing antigenic domains on the fusion protein of respiratory syncytial virus.

    ID: 1483290

    Description: epitope description:PIVNKQSCSISNIETVIEFQQ antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus

    Publication: 2033389;

  7. Use of synthetic peptides to locate neutralizing antigenic domains on the fusion protein of respiratory syncytial virus.

    ID: 1483292

    Description: epitope description:PIVNKQSCSISNIETVIEFQQ antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus

    Publication: 2033389;

  8. Epitope mapping of HTLV envelope seroreactivity in LGL leukaemia.

    ID: 1483331

    Description: epitope description:IVKNHQNILRVAQYAAQNRRGLDLLFWEQGGLCKAIQEQCCFLN antigen name:Envelope glycoprotein gp63 host organism:Homo sapiens

    Publication: 9609528;

  9. Epitope mapping of HTLV envelope seroreactivity in LGL leukaemia.

    ID: 1483334

    Description: epitope description:QEQCRFPNITNSHVSILQERPPLENRVLTGWGLN antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 9609528;

  10. Cross-reactivity between immunodominant human T lymphotropic virus type I tax and neurons: implications for molecular mimicry.

    ID: 1483367

    Description: epitope description:KHFRETEV antigen name:Protein Tax-1 host organism:Mus musculus antibody name:Tab169, Tab 170, Tab 171

    Publication: 12404172;

  11. Identification of foot-and-mouth disease virus-specific linear B-cell epitopes to differentiate between infected and vaccinated cattle.

    ID: 1483378

    Description: epitope description:PFFFSDVRSNFSKLV antigen name:Polyprotein host organism:Bos taurus

    Publication: 12885881;

  12. Identification of foot-and-mouth disease virus-specific linear B-cell epitopes to differentiate between infected and vaccinated cattle.

    ID: 1483393

    Description: epitope description:GPYAGPMERQKPLK antigen name:Polyprotein host organism:Bos taurus

    Publication: 12885881;

  13. Identification of foot-and-mouth disease virus-specific linear B-cell epitopes to differentiate between infected and vaccinated cattle.

    ID: 1483405

    Description: epitope description:LKARDINDIFAILKN antigen name:Polyprotein host organism:Bos taurus

    Publication: 12885881;

  14. Identification of foot-and-mouth disease virus-specific linear B-cell epitopes to differentiate between infected and vaccinated cattle.

    ID: 1483411

    Description: epitope description:LKARDINDIFAILKN antigen name:Polyprotein host organism:Bos taurus

    Publication: 12885881;

  15. Identification of foot-and-mouth disease virus-specific linear B-cell epitopes to differentiate between infected and vaccinated cattle.

    ID: 1483415

    Description: epitope description:SEEKFVTMTDLVPGI antigen name:Polyprotein host organism:Bos taurus

    Publication: 12885881;

  16. Identification of foot-and-mouth disease virus-specific linear B-cell epitopes to differentiate between infected and vaccinated cattle.

    ID: 1483417

    Description: epitope description:SEEKFVTMTDLVPGI antigen name:Polyprotein host organism:Bos taurus

    Publication: 12885881;

  17. Identification of foot-and-mouth disease virus-specific linear B-cell epitopes to differentiate between infected and vaccinated cattle.

    ID: 1483419

    Description: epitope description:VTMTDLVPGILEKQR antigen name:Polyprotein host organism:Bos taurus

    Publication: 12885881;

  18. Identification of foot-and-mouth disease virus-specific linear B-cell epitopes to differentiate between infected and vaccinated cattle.

    ID: 1483421

    Description: epitope description:VTMTDLVPGILEKQR antigen name:Polyprotein host organism:Bos taurus

    Publication: 12885881;

  19. Identification of foot-and-mouth disease virus-specific linear B-cell epitopes to differentiate between infected and vaccinated cattle.

    ID: 1483426

    Description: epitope description:NEYIEKANITTDDK antigen name:Polyprotein host organism:Bos taurus

    Publication: 12885881;

  20. Use of a pre-selected epitope of cathepsin-L1 in a highly specific peptide-based immunoassay for the diagnosis of Fasciola hepatica infections in catt...

    ID: 1483447

    Description: epitope description:GSNDDLWHQWKRMYNKEYN antigen name:Other Fasciola hepatica (liver fluke) protein host organism:Bos taurus Holstein-Friesian

    Publication: 10404262;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston