Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

ID: 1466096

Description: epitope description:PVKKPVALKVKAKN antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

ID: 1466112

Description: epitope description:REITFIYKSSCTDSDH antigen name:envelope polyprotein host organism:Equus caballus

Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

ID: 1466113

Description: epitope description:TDSDHCQEYQCKKVNLNSSDS antigen name:envelope polyprotein host organism:Equus caballus

Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

ID: 1466115

Description: epitope description:SSDSSNSVRVEDVTNTAEYWGFKWLECNQT antigen name:envelope polyprotein host organism:Equus caballus

Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

ID: 1466121

Description: epitope description:KGCNETWARVKRCPIDILYGIHPIRLCVQ antigen name:envelope polyprotein host organism:Equus caballus