Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Citrulline is an essential constituent of antigenic determinants recognized by rheumatoid arthritis-specific autoantibodies.

    ID: 1649692

    Description: epitope description:SHQESTRGRSRGRSGRSGS + CITR(R7, R11) antigen name:Filaggrin host organism:Homo sapiens

    Publication: 9421490;

  2. Citrulline is an essential constituent of antigenic determinants recognized by rheumatoid arthritis-specific autoantibodies.

    ID: 1649703

    Description: epitope description:ESSHGWTGPSTRGRQGSRHE antigen name:Filaggrin host organism:Homo sapiens

    Publication: 9421490;

  3. Citrulline is an essential constituent of antigenic determinants recognized by rheumatoid arthritis-specific autoantibodies.

    ID: 1649706

    Description: epitope description:TGPSTRGRQGSRHEQAQ + CITR(R8) antigen name:Filaggrin host organism:Homo sapiens

    Publication: 9421490;

  4. Identification of the pentapeptide constituting a dominant epitope common to all eukaryotic heat shock protein 90 molecular chaperones.

    ID: 1649717

    Description: epitope description:VWTRAELIGAFG host organism:Mus musculus antibody name:K3720

    Publication: 16333984;

  5. Identification of the pentapeptide constituting a dominant epitope common to all eukaryotic heat shock protein 90 molecular chaperones.

    ID: 1649725

    Description: epitope description:GRGGAIWDRPEF host organism:Mus musculus antibody name:K41338

    Publication: 16333984;

  6. Cartilage-specific autoimmunity in rheumatoid arthritis: characterization of a triple helical B cell epitope in the integrin-binding-domain of collage...

    ID: 1649757

    Description: epitope description:LVGPRGERGFP + HYL(P628) antigen name:Collagen alpha-1(II) chain host organism:Homo sapiens

    Publication: 11385610;

  7. Cartilage-specific autoimmunity in rheumatoid arthritis: characterization of a triple helical B cell epitope in the integrin-binding-domain of collage...

    ID: 1649759

    Description: epitope description:LVGPRGERGFP + HYL(P628) antigen name:Collagen alpha-1(II) chain host organism:Homo sapiens

    Publication: 11385610;

  8. Synthesis of overlapping fibrin citrullinated peptides and their use for diagnosing rheumatoid arthritis.

    ID: 1649764

    Description: epitope description:GHAKSRPVRG + CITR(6R, 9R) antigen name:Fibrinogen alpha chain host organism:Homo sapiens

    Publication: 17105483;

  9. Synthesis of overlapping fibrin citrullinated peptides and their use for diagnosing rheumatoid arthritis.

    ID: 1649765

    Description: epitope description:HSTKRGHAKSRPVRG + CITR(5R, 11R, 14R) antigen name:Fibrinogen alpha chain host organism:Homo sapiens

    Publication: 17105483;

  10. Synthesis of overlapping fibrin citrullinated peptides and their use for diagnosing rheumatoid arthritis.

    ID: 1649766

    Description: epitope description:DHEGTHSTKRGHAKSRPVRG + CITR(10R, 16R, 19R) antigen name:Fibrinogen alpha chain host organism:Homo sapiens

    Publication: 17105483;

  11. Synthesis of overlapping fibrin citrullinated peptides and their use for diagnosing rheumatoid arthritis.

    ID: 1649776

    Description: epitope description:GHAKSRPVRG + CITR(6R, 9R) antigen name:Fibrinogen alpha chain host organism:Homo sapiens

    Publication: 17105483;

  12. Synthesis of overlapping fibrin citrullinated peptides and their use for diagnosing rheumatoid arthritis.

    ID: 1649778

    Description: epitope description:DHEGTHSTKRGHAKSRPVRG + CITR(10R, 16R, 19R) antigen name:Fibrinogen alpha chain host organism:Homo sapiens

    Publication: 17105483;

  13. Synthesis of overlapping fibrin citrullinated peptides and their use for diagnosing rheumatoid arthritis.

    ID: 1649780

    Description: epitope description:ARGHRPLDKKREEAPSLRPA + CITR(2R, 5R, 11R, 18R) antigen name:Fibrinogen beta chain host organism:Homo sapiens

    Publication: 17105483;

  14. Depletion of interfering antibodies in chronic hepatitis C patients and vaccinated chimpanzees reveals broad cross-genotype neutralizing activity.

    ID: 1649806

    Description: epitope description:QLINTNGSWHINSTA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 19380744;

  15. Analysis of collagenase-cleavage of type II collagen using a neoepitope ELISA.

    ID: 1649822

    Description: epitope description:GPPGPQG antigen name:Collagen alpha-1(II) chain host organism:Mus musculus BALB/c antibody name:9A4

    Publication: 11150534;

  16. Probing antinuclear antibody specificities by peptide phage display libraries.

    ID: 1649831

    Description: epitope description:GLEGQDTKTITFDVS host organism:Homo sapiens

    Publication: 10949721;

  17. Probing antinuclear antibody specificities by peptide phage display libraries.

    ID: 1649842

    Description: epitope description:QTRGFPSCERGYLSP host organism:Homo sapiens

    Publication: 10949721;

  18. Probing antinuclear antibody specificities by peptide phage display libraries.

    ID: 1649848

    Description: epitope description:AVSNRPRLKDTTYRL host organism:Homo sapiens

    Publication: 10949721;

  19. Probing antinuclear antibody specificities by peptide phage display libraries.

    ID: 1649853

    Description: epitope description:MSVPQTTYSKITELI host organism:Homo sapiens

    Publication: 10949721;

  20. Mapping of an antigenic site on the nucleocapsid protein of human parainfluenza virus type 3.

    ID: 1650058

    Description: epitope description:GEPQSSIIQY antigen name:nucleoprotein host organism:Mus musculus BALB/c antibody name:5C9, 11H7

    Publication: 19435414;

  21. Mapping of an antigenic site on the nucleocapsid protein of human parainfluenza virus type 3.

    ID: 1650060

    Description: epitope description:GEPQSSIIQY antigen name:nucleoprotein host organism:Homo sapiens

    Publication: 19435414;

  22. The inhibition of the interaction between the anthrax toxin and its cellular receptor by an anti-receptor monoclonal antibody.

    ID: 1650083

    Description: epitope description:YIHEGLK antigen name:Anthrax toxin receptor 2 host organism:Mus musculus BALB/c antibody name:4B5

    Publication: 19486894;

  23. The inhibition of the interaction between the anthrax toxin and its cellular receptor by an anti-receptor monoclonal antibody.

    ID: 1650085

    Description: epitope description:YIHEGLK antigen name:Anthrax toxin receptor 2 host organism:Mus musculus BALB/c antibody name:4B5

    Publication: 19486894;

  24. Antigenic determinants reacting with rheumatoid factor: epitopes with different primary sequences share similar conformation.

    ID: 1650153

    Description: epitope description:EGLHNHY antigen name:Immunoglobulin host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit sera

    Publication: 9364220;

  25. Identification of conformation-dependent epitopes and V gene selection in the B cell response to type II collagen in the DA rat.

    ID: 1650156

    Description: epitope description:ARGLTGRPGDA antigen name:Collagen alpha-1(II) chain host organism:Rattus norvegicus DA antibody name:125.5, 126.35, 145.322, 146.5...

    Publication: 11431421;

  26. Antigenic determinants reacting with rheumatoid factor: epitopes with different primary sequences share similar conformation.

    ID: 1650179

    Description: epitope description:EGLHNHY antigen name:Immunoglobulin host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit sera

    Publication: 9364220;

  27. Identification of conformation-dependent epitopes and V gene selection in the B cell response to type II collagen in the DA rat.

    ID: 1650182

    Description: epitope description:GPRGLPGERGRTGPAGAAG antigen name:Collagen alpha-1(II) chain host organism:Rattus norvegicus DA antibody name:122.41

    Publication: 11431421;

  28. Antigenic determinants reacting with rheumatoid factor: epitopes with different primary sequences share similar conformation.

    ID: 1650183

    Description: epitope description:VLTVLHQNWL antigen name:Immunoglobulin host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit sera

    Publication: 9364220;

  29. Antigenic determinants reacting with rheumatoid factor: epitopes with different primary sequences share similar conformation.

    ID: 1650186

    Description: epitope description:VLTVLHQNWL antigen name:Immunoglobulin host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit sera

    Publication: 9364220;

  30. Identification of conformation-dependent epitopes and V gene selection in the B cell response to type II collagen in the DA rat.

    ID: 1650193

    Description: epitope description:LVGPRGERGFP antigen name:Collagen alpha-1(II) chain host organism:Rattus norvegicus DA antibody name:126.30

    Publication: 11431421;

  31. Identification of conformation-dependent epitopes and V gene selection in the B cell response to type II collagen in the DA rat.

    ID: 1650194

    Description: epitope description:LVGPRGERGFP antigen name:Collagen alpha-1(II) chain host organism:Rattus norvegicus DA antibody name:126.30

    Publication: 11431421;

  32. Antigenic determinants reacting with rheumatoid factor: epitopes with different primary sequences share similar conformation.

    ID: 1650204

    Description: epitope description:LSQPKIVKWDR antigen name:Beta-2-microglobulin host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit sera

    Publication: 9364220;

  33. Antigenic determinants reacting with rheumatoid factor: epitopes with different primary sequences share similar conformation.

    ID: 1650205

    Description: epitope description:SKDWSFY antigen name:Beta-2-microglobulin host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit sera

    Publication: 9364220;

  34. Antigenic determinants reacting with rheumatoid factor: epitopes with different primary sequences share similar conformation.

    ID: 1650209

    Description: epitope description:SKDWSFY antigen name:Beta-2-microglobulin host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit sera

    Publication: 9364220;

  35. Antigenic determinants reacting with rheumatoid factor: epitopes with different primary sequences share similar conformation.

    ID: 1650216

    Description: epitope description:SKDWSFY antigen name:Beta-2-microglobulin host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit sera

    Publication: 9364220;

  36. Antigenic determinants reacting with rheumatoid factor: epitopes with different primary sequences share similar conformation.

    ID: 1650232

    Description: epitope description:EGLHNHY antigen name:Immunoglobulin host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit sera

    Publication: 9364220;

  37. Antigenic determinants reacting with rheumatoid factor: epitopes with different primary sequences share similar conformation.

    ID: 1650234

    Description: epitope description:EGLHNHY antigen name:Immunoglobulin host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit sera

    Publication: 9364220;

  38. Antigenic determinants reacting with rheumatoid factor: epitopes with different primary sequences share similar conformation.

    ID: 1650236

    Description: epitope description:EGLHNHY antigen name:Immunoglobulin host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit sera

    Publication: 9364220;

  39. Aberrant expression of the autoantigen heterogeneous nuclear ribonucleoprotein-A2 (RA33) and spontaneous formation of rheumatoid arthritis-associated ...

    ID: 1650237

    Description: epitope description:RGFGFVTFSSMAEVDAAMAAR antigen name:Heterogeneous nuclear ribonucleoproteins A2/B1 host organism:Mus musculus hTNF Tg

    Publication: 16339574;

  40. Antigenic determinants reacting with rheumatoid factor: epitopes with different primary sequences share similar conformation.

    ID: 1650249

    Description: epitope description:VLTVLHQNWL antigen name:Immunoglobulin host organism:Mus musculus antibody name:BBM.1 and F 20.11C

    Publication: 9364220;

  41. Antigenic determinants reacting with rheumatoid factor: epitopes with different primary sequences share similar conformation.

    ID: 1650250

    Description: epitope description:SKDWSFY antigen name:Beta-2-microglobulin host organism:Mus musculus antibody name:BBM.1 and F 20.11C

    Publication: 9364220;

  42. Aberrant expression of the autoantigen heterogeneous nuclear ribonucleoprotein-A2 (RA33) and spontaneous formation of rheumatoid arthritis-associated ...

    ID: 1650256

    Description: epitope description:KRGFGFVTFDDHDPVDKIVLQ antigen name:Heterogeneous nuclear ribonucleoproteins A2/B1 host organism:Mus musculus hTNF Tg

    Publication: 16339574;

  43. Aberrant expression of the autoantigen heterogeneous nuclear ribonucleoprotein-A2 (RA33) and spontaneous formation of rheumatoid arthritis-associated ...

    ID: 1650262

    Description: epitope description:EPKRAVAREESGKPGAHVTVK antigen name:Heterogeneous nuclear ribonucleoproteins A2/B1 host organism:Mus musculus hTNF Tg

    Publication: 16339574;

  44. Aberrant expression of the autoantigen heterogeneous nuclear ribonucleoprotein-A2 (RA33) and spontaneous formation of rheumatoid arthritis-associated ...

    ID: 1650263

    Description: epitope description:REESGKPGAHVTVKKLFVGGIKED antigen name:Heterogeneous nuclear ribonucleoproteins A2/B1 host organism:Mus musculus hTNF Tg

    Publication: 16339574;

  45. Antigenic determinants reacting with rheumatoid factor: epitopes with different primary sequences share similar conformation.

    ID: 1650284

    Description: epitope description:KFNWYVD antigen name:Immunoglobulin host organism:Mus musculus antibody name:KFNWYVD mAb

    Publication: 9364220;

  46. Analysis of collagenase-cleavage of type II collagen using a neoepitope ELISA.

    ID: 1650289

    Description: epitope description:GEPGDDAPSC host organism:Mus musculus BALB/c antibody name:5109

    Publication: 11150534;

  47. Antigenic determinants reacting with rheumatoid factor: epitopes with different primary sequences share similar conformation.

    ID: 1650298

    Description: epitope description:KFNWYVD antigen name:Immunoglobulin host organism:Mus musculus antibody name:KFNWYVD mAb

    Publication: 9364220;

  48. Antigenic determinants reacting with rheumatoid factor: epitopes with different primary sequences share similar conformation.

    ID: 1650300

    Description: epitope description:KFNWYVD antigen name:Immunoglobulin host organism:Mus musculus antibody name:KFNWYVD mAb

    Publication: 9364220;

  49. Monoclonal antibodies and conserved antigenic epitopes in the C terminus of GP5 protein of the North American type porcine reproductive and respirator...

    ID: 1650308

    Description: epitope description:EGHLIDLKRV antigen name:Glycoprotein 5 host organism:Mus musculus BALB/c antibody name:53A2, 53A12, 53B9, 54A4

    Publication: 19427138;

  50. Monoclonal antibodies and conserved antigenic epitopes in the C terminus of GP5 protein of the North American type porcine reproductive and respirator...

    ID: 1650322

    Description: epitope description:LDTKGRLYRWR antigen name:Glycoprotein 5 host organism:Sus scrofa

    Publication: 19427138;

  51. Monoclonal antibodies and conserved antigenic epitopes in the C terminus of GP5 protein of the North American type porcine reproductive and respirator...

    ID: 1650324

    Description: epitope description:GKVEVEGHLIDLKRVVL antigen name:Glycoprotein 5 host organism:Sus scrofa

    Publication: 19427138;

  52. Monoclonal antibodies and conserved antigenic epitopes in the C terminus of GP5 protein of the North American type porcine reproductive and respirator...

    ID: 1650326

    Description: epitope description:VSAEQWGRL antigen name:Glycoprotein 5 host organism:Sus scrofa

    Publication: 19427138;

  53. Electrical detection of beta-amyloid (1-40) using scanning tunneling microscopy.

    ID: 1650331

    Description: epitope description:DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV antigen name:Amyloid beta A4 protein host organism:Mus musculus

    Publication: 19345496;

  54. Antigenic characterization and cytolocalization of P35, the major Mycoplasma penetrans antigen.

    ID: 1650336

    Description: epitope description:AIKSEVSLTGAL antigen name:Lipoprotein p35 host organism:Macaca

    Publication: 10075417;

  55. Antigenic characterization and cytolocalization of P35, the major Mycoplasma penetrans antigen.

    ID: 1650337

    Description: epitope description:AIKSEVSLTGAL antigen name:Lipoprotein p35 host organism:Homo sapiens

    Publication: 10075417;

  56. Peptide mimotopes of rabies virus glycoprotein with immunogenic activity.

    ID: 1650351

    Description: epitope description:CKYWWSKC host organism:Homo sapiens antibody name:hRABVIgG

    Publication: 19520204;

  57. Peptide mimotopes of rabies virus glycoprotein with immunogenic activity.

    ID: 1650354

    Description: epitope description:CKYAWSRC host organism:Homo sapiens antibody name:hRABVIgG

    Publication: 19520204;

  58. Antigenic determinants reacting with rheumatoid factor: epitopes with different primary sequences share similar conformation.

    ID: 1650375

    Description: epitope description:PREPQVY antigen name:Immunoglobulin host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit sera

    Publication: 9364220;

  59. Antigenic determinants reacting with rheumatoid factor: epitopes with different primary sequences share similar conformation.

    ID: 1650401

    Description: epitope description:LHNHYT antigen name:Immunoglobulin host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabbit sera

    Publication: 9364220;

  60. Location of antigenic sites recognized by monoclonal antibodies in the influenza A virus nucleoprotein molecule.

    ID: 1650456

    Description: epitope description:K470 antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:3/1

    Publication: 19297605;

  61. Bioinformatics and immunologic investigation on B and T cell epitopes of Cur l 3, a major allergen of Curvularia lunata.

    ID: 1650533

    Description: epitope description:QGDAKKGANLFKTRC antigen name:Cur l 3 host organism:Homo sapiens

    Publication: 19290623;

  62. Bioinformatics and immunologic investigation on B and T cell epitopes of Cur l 3, a major allergen of Curvularia lunata.

    ID: 1650534

    Description: epitope description:LKAGEGNKIGPE antigen name:Cur l 3 host organism:Homo sapiens

    Publication: 19290623;

  63. Bioinformatics and immunologic investigation on B and T cell epitopes of Cur l 3, a major allergen of Curvularia lunata.

    ID: 1650540

    Description: epitope description:GLFGRKTGSVA antigen name:Cur l 3 host organism:Homo sapiens

    Publication: 19290623;

  64. Bioinformatics and immunologic investigation on B and T cell epitopes of Cur l 3, a major allergen of Curvularia lunata.

    ID: 1650541

    Description: epitope description:VAGYSYTDANK antigen name:Cur l 3 host organism:Homo sapiens

    Publication: 19290623;

  65. Human autoantibodies to a synthetic putative T cell receptor beta-chain regulatory idiotype: expression in autoimmunity and aging.

    ID: 1650593

    Description: epitope description:CKPISGHNSLFWYRQT antigen name:T-cell receptor host organism:Homo sapiens

    Publication: 8398197;

  66. A rheumatoid factor specific mimotope identified by a peptide display library.

    ID: 1650598

    Description: epitope description:GWVAMHPQGDL host organism:Homo sapiens antibody name:B'20

    Publication: 10520896;

  67. The prognostic value of anti-cyclic citrullinated peptide antibody in patients with recent-onset rheumatoid arthritis.

    ID: 1650599

    Description: epitope description:HQCHQESTRGRSRGRCGRSGS + CITR(R9) host organism:Homo sapiens

    Publication: 10943873;

  68. A rheumatoid factor specific mimotope identified by a peptide display library.

    ID: 1650600

    Description: epitope description:NWLSLITAAR host organism:Homo sapiens antibody name:B'20

    Publication: 10520896;

  69. Location of antigenic sites recognized by monoclonal antibodies in the influenza A virus nucleoprotein molecule.

    ID: 1650618

    Description: epitope description:K470 antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:3/1

    Publication: 19297605;

  70. Location of antigenic sites recognized by monoclonal antibodies in the influenza A virus nucleoprotein molecule.

    ID: 1650625

    Description: epitope description:E372 antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:150/4

    Publication: 19297605;

  71. Preparation, physiochemical characterization, and oral immunogenicity of Abeta(1-12), Abeta(29-40), and Abeta(1-42) loaded PLG microparticles formulat...

    ID: 1650664

    Description: epitope description:GAIIGLMVGGVV antigen name:Amyloid beta A4 protein host organism:Mus musculus BALB/c

    Publication: 18980172;

  72. Candidate vaccine focused on a classical Swine Fever virus epitope induced antibodies with neutralizing activity.

    ID: 1650667

    Description: epitope description:LGSTAVSPTTLRGSTAVSPTTLRGS host organism:Oryctolagus cuniculus

    Publication: 19435417;

  73. Characterization of a novel protective monoclonal antibody that recognizes an epitope common to Vibrio cholerae Ogawa and Inaba serotypes.

    ID: 1650712

    Description: epitope description:NQYCIYAGRYC host organism:Mus musculus BALB/c antibody name:mAb 72.1

    Publication: 19389772;

  74. Characterization of a novel protective monoclonal antibody that recognizes an epitope common to Vibrio cholerae Ogawa and Inaba serotypes.

    ID: 1650715

    Description: epitope description:FCQPHLSCYILP host organism:Mus musculus BALB/c antibody name:mAb 72.1

    Publication: 19389772;

  75. Characterization of a novel protective monoclonal antibody that recognizes an epitope common to Vibrio cholerae Ogawa and Inaba serotypes.

    ID: 1650724

    Description: epitope description:CWNYCLP host organism:Mus musculus BALB/c antibody name:mAb 72.1

    Publication: 19389772;

  76. Characterization of a novel protective monoclonal antibody that recognizes an epitope common to Vibrio cholerae Ogawa and Inaba serotypes.

    ID: 1650733

    Description: epitope description:CLFPNNSYC host organism:Mus musculus BALB/c antibody name:mAb 72.1

    Publication: 19389772;

  77. Peptide mimics of two pneumococcal capsular polysaccharide serotypes (6B and 9V) protect mice from a lethal challenge with Streptococcus pneumoniae.

    ID: 1650921

    Description: epitope description:KFHPKDIPYQVW host organism:Mus musculus BALB/c

    Publication: 19499518;

  78. Cloning, expression, and mapping of allergenic determinants of alphaS1-casein, a major cow's milk allergen.

    ID: 1650925

    Description: epitope description:RPKHPIKHQGLPQEVLNENLLRFFVAPFPEV antigen name:Bos d 9 host organism:Homo sapiens

    Publication: 19454699;

  79. Cloning, expression, and mapping of allergenic determinants of alphaS1-casein, a major cow's milk allergen.

    ID: 1650930

    Description: epitope description:ISSSEEIVPNSVEQKHIQKEDVPSERYLGYLEQLLR antigen name:Bos d 9 host organism:Homo sapiens

    Publication: 19454699;

  80. Cloning, expression, and mapping of allergenic determinants of alphaS1-casein, a major cow's milk allergen.

    ID: 1650932

    Description: epitope description:LKKYKVPQLEIVPNSAEERLHSMKEGIHAQQKE antigen name:Bos d 9 host organism:Homo sapiens

    Publication: 19454699;

  81. Peptide mimics of two pneumococcal capsular polysaccharide serotypes (6B and 9V) protect mice from a lethal challenge with Streptococcus pneumoniae.

    ID: 1650937

    Description: epitope description:HKKDFARGPGWS host organism:Mus musculus BALB/c

    Publication: 19499518;

  82. Peptide mimics of two pneumococcal capsular polysaccharide serotypes (6B and 9V) protect mice from a lethal challenge with Streptococcus pneumoniae.

    ID: 1650941

    Description: epitope description:RQFECYTTCVG host organism:Mus musculus MF1

    Publication: 19499518;

  83. Peptide mimics of two pneumococcal capsular polysaccharide serotypes (6B and 9V) protect mice from a lethal challenge with Streptococcus pneumoniae.

    ID: 1650944

    Description: epitope description:RQGEEVYMWRDSMPA host organism:Mus musculus MF1

    Publication: 19499518;

  84. Peptide mimics of two pneumococcal capsular polysaccharide serotypes (6B and 9V) protect mice from a lethal challenge with Streptococcus pneumoniae.

    ID: 1650978

    Description: epitope description:WEWDWPRIELNI host organism:Homo sapiens antibody name:mAB Db3G9

    Publication: 19499518;

  85. Peptide mimics of two pneumococcal capsular polysaccharide serotypes (6B and 9V) protect mice from a lethal challenge with Streptococcus pneumoniae.

    ID: 1650981

    Description: epitope description:YSLLVEPYTFDP host organism:Mus musculus MF1

    Publication: 19499518;

  86. Peptide mimics of two pneumococcal capsular polysaccharide serotypes (6B and 9V) protect mice from a lethal challenge with Streptococcus pneumoniae.

    ID: 1650988

    Description: epitope description:DWPAVIFEDTRA host organism:Homo sapiens antibody name:mAB Db3G9

    Publication: 19499518;

  87. Peptide mimics of two pneumococcal capsular polysaccharide serotypes (6B and 9V) protect mice from a lethal challenge with Streptococcus pneumoniae.

    ID: 1650994

    Description: epitope description:KFHPKDIPYQVW host organism:Mus musculus MF1

    Publication: 19499518;

  88. Arthritis-related B cell epitopes in collagen II are conformation-dependent and sterically privileged in accessible sites of cartilage collagen fibril...

    ID: 1651018

    Description: epitope description:ARGLTGRPGDA antigen name:Collagen alpha-1(II) chain host organism:Mus musculus DBA/1 antibody name:D8, CB 300, CB 313, M2 87, M2 8...

    Publication: 9430695;

  89. Arthritis-related B cell epitopes in collagen II are conformation-dependent and sterically privileged in accessible sites of cartilage collagen fibril...

    ID: 1651022

    Description: epitope description:LAGQRGIV antigen name:Collagen alpha-1(II) chain host organism:Mus musculus DBA/1 antibody name:F10

    Publication: 9430695;

  90. Arthritis-related B cell epitopes in collagen II are conformation-dependent and sterically privileged in accessible sites of cartilage collagen fibril...

    ID: 1651023

    Description: epitope description:HRGFT antigen name:Collagen alpha-1(II) chain host organism:Mus musculus DBA/1 antibody name:F4, LN2 423

    Publication: 9430695;

  91. Marked differences in fine specificity and isotype usage of the anti-citrullinated protein antibody in health and disease.

    ID: 1651180

    Description: epitope description:NEEGFFSARGHRPLDKK + CITR(R9) antigen name:Fibrinogen beta chain host organism:Homo sapiens

    Publication: 18821680;

  92. Marked differences in fine specificity and isotype usage of the anti-citrullinated protein antibody in health and disease.

    ID: 1651182

    Description: epitope description:KIHAREIFDSRGNPTV + CITR(R5, R11) antigen name:Alpha-enolase host organism:Homo sapiens

    Publication: 18821680;

  93. Major species-specific antibody epitopes of the Ehrlichia chaffeensis p120 and E. canis p140 orthologs in surface-exposed tandem repeat regions.

    ID: 1651251

    Description: epitope description:SSSEPFVAESEVSKVEQEETNP antigen name:120 kDa immunodominant surface protein host organism:Canis lupus familiaris

    Publication: 19420187;

  94. Major species-specific antibody epitopes of the Ehrlichia chaffeensis p120 and E. canis p140 orthologs in surface-exposed tandem repeat regions.

    ID: 1651255

    Description: epitope description:ETNPEVLIKDLQDVAS antigen name:120 kDa immunodominant surface protein host organism:Canis lupus familiaris

    Publication: 19420187;

  95. Major species-specific antibody epitopes of the Ehrlichia chaffeensis p120 and E. canis p140 orthologs in surface-exposed tandem repeat regions.

    ID: 1651257

    Description: epitope description:QVVTERESEIESHQGETEKESG antigen name:120 kDa immunodominant surface protein host organism:Canis lupus familiaris

    Publication: 19420187;

  96. Major species-specific antibody epitopes of the Ehrlichia chaffeensis p120 and E. canis p140 orthologs in surface-exposed tandem repeat regions.

    ID: 1651260

    Description: epitope description:SSSEPFVAESEVSKVEQEETNP antigen name:120 kDa immunodominant surface protein host organism:Homo sapiens

    Publication: 19420187;

  97. Major species-specific antibody epitopes of the Ehrlichia chaffeensis p120 and E. canis p140 orthologs in surface-exposed tandem repeat regions.

    ID: 1651265

    Description: epitope description:ETNPEVLIKDLQDVAS antigen name:120 kDa immunodominant surface protein host organism:Homo sapiens

    Publication: 19420187;

  98. Major species-specific antibody epitopes of the Ehrlichia chaffeensis p120 and E. canis p140 orthologs in surface-exposed tandem repeat regions.

    ID: 1651266

    Description: epitope description:DLQDVASHESGVSDQPAQVVTER antigen name:120 kDa immunodominant surface protein host organism:Homo sapiens

    Publication: 19420187;

  99. Major species-specific antibody epitopes of the Ehrlichia chaffeensis p120 and E. canis p140 orthologs in surface-exposed tandem repeat regions.

    ID: 1651275

    Description: epitope description:SKEENTPEVKA antigen name:Gp140 host organism:Canis lupus familiaris

    Publication: 19420187;

  100. Two distinctly HLA-associated contiguous linear epitopes uniquely expressed within the islet antigen 2 molecule are major autoantibody epitopes of the...

    ID: 1651289

    Description: epitope description:RLAALGPEGAHGDTTFEYQDL antigen name:Receptor-type tyrosine-protein phosphatase-like N host organism:Homo sapiens

    Publication: 11937581;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston