Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Antibody to a synthetic peptide detects a conserved region of retrovirus transmembrane proteins.

    ID: 1465980

    Description: epitope description:EVVLQNRRGLDLL antigen name:Envelope glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 3977884;

  2. Antibody to a synthetic peptide detects a conserved region of retrovirus transmembrane proteins.

    ID: 1465981

    Description: epitope description:EVVLQNRRGLDLL antigen name:Envelope glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 3977884;

  3. Localization and characterization of Sendai virus nonstructural C and C' proteins by antibodies against synthetic peptides.

    ID: 1465993

    Description: epitope description:MPSFLKKILKLRGRRQEEESRSRMLSDSSM antigen name:Protein C' host organism:Oryctolagus cuniculus antibody name:Rabbit antisera

    Publication: 3026113;

  4. Localization and characterization of Sendai virus nonstructural C and C' proteins by antibodies against synthetic peptides.

    ID: 1465995

    Description: epitope description:YVKSLSKCKTDQEVKAVMELVEEDIESLTN antigen name:Phosphoprotein host organism:Oryctolagus cuniculus antibody name:Rabbit antisera

    Publication: 3026113;

  5. Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

    ID: 1466001

    Description: epitope description:FFRSTPEDLERAEK antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

    Publication: 14645912;

  6. Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

    ID: 1466020

    Description: epitope description:PVKKPVALKVKAKN antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

    Publication: 14645912;

  7. Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

    ID: 1466022

    Description: epitope description:YNRNAVPNLRGDLQV antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

    Publication: 14645912;

  8. Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

    ID: 1466040

    Description: epitope description:SEKSKCEENTMFQPY antigen name:envelope polyprotein host organism:Equus caballus

    Publication: 1370556;

  9. Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

    ID: 1466042

    Description: epitope description:SEEKFVTMTDLVPGI antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

    Publication: 14645912;

  10. Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

    ID: 1466044

    Description: epitope description:SEEKFVTMTDLVPGI antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

    Publication: 14645912;

  11. Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

    ID: 1466046

    Description: epitope description:VTMTDLVPGILEKQR antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

    Publication: 14645912;

  12. Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

    ID: 1466047

    Description: epitope description:VTMTDLVPGILEKQR antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

    Publication: 14645912;

  13. Assessment of protective immune responses against hydatid disease in sheep by immunization with synthetic peptide antigens.

    ID: 1466050

    Description: epitope description:TETPLRKHFNLTPV antigen name:Antigen protein host organism:Ovis aries Merino X Border Leiscester

    Publication: 11085234;

  14. Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

    ID: 1466052

    Description: epitope description:NEYIEKANITTDDK antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

    Publication: 14645912;

  15. Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

    ID: 1466060

    Description: epitope description:ERTLPGQKACDDVN antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

    Publication: 14645912;

  16. Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

    ID: 1466063

    Description: epitope description:GPYAGPLERQKPLK antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

    Publication: 14645912;

  17. Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

    ID: 1466067

    Description: epitope description:PYCYNNDSKNSMAESKEAR antigen name:envelope polyprotein host organism:Equus caballus

    Publication: 1370556;

  18. Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

    ID: 1466075

    Description: epitope description:WGSFPGCRPFQNYFSYET antigen name:envelope polyprotein host organism:Equus caballus

    Publication: 1370556;

  19. Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

    ID: 1466076

    Description: epitope description:WGSFPGCRPFQNYFSYET antigen name:envelope polyprotein host organism:Equus caballus

    Publication: 1370556;

  20. Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

    ID: 1466085

    Description: epitope description:PLERQKPLKVRAKL antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

    Publication: 14645912;

  21. Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

    ID: 1466087

    Description: epitope description:GPYAGPMERQKPLK antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

    Publication: 14645912;

  22. Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

    ID: 1466088

    Description: epitope description:GPYAGPMERQKPLK antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

    Publication: 14645912;

  23. Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

    ID: 1466089

    Description: epitope description:GPYAGPMERQKPLK antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

    Publication: 14645912;

  24. Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

    ID: 1466091

    Description: epitope description:PMERQKPLKVKAKA antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

    Publication: 14645912;

  25. Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

    ID: 1466093

    Description: epitope description:PMERQKPLKVKAKA antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

    Publication: 14645912;

  26. Induction of an antigen-specific immune response and partial protection of cattle against challenge infection with foot-and-mouth disease virus (FMDV)...

    ID: 1466096

    Description: epitope description:PVKKPVALKVKAKN antigen name:Polyprotein host organism:Bos taurus antibody name:Bovine sera

    Publication: 14645912;

  27. Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

    ID: 1466112

    Description: epitope description:REITFIYKSSCTDSDH antigen name:envelope polyprotein host organism:Equus caballus

    Publication: 1370556;

  28. Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

    ID: 1466113

    Description: epitope description:TDSDHCQEYQCKKVNLNSSDS antigen name:envelope polyprotein host organism:Equus caballus

    Publication: 1370556;

  29. Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

    ID: 1466115

    Description: epitope description:SSDSSNSVRVEDVTNTAEYWGFKWLECNQT antigen name:envelope polyprotein host organism:Equus caballus

    Publication: 1370556;

  30. Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

    ID: 1466121

    Description: epitope description:KGCNETWARVKRCPIDILYGIHPIRLCVQ antigen name:envelope polyprotein host organism:Equus caballus

    Publication: 1370556;

  31. Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

    ID: 1466124

    Description: epitope description:RLCVQPPFFLVQEKGIADTSR antigen name:envelope polyprotein host organism:Equus caballus

    Publication: 1370556;

  32. Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

    ID: 1466126

    Description: epitope description:ADTSRIGNCGPTIFLGVLED antigen name:envelope polyprotein host organism:Equus caballus

    Publication: 1370556;

  33. Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

    ID: 1466127

    Description: epitope description:LGVLEDNKGVVRGDYTAC antigen name:envelope polyprotein host organism:Equus caballus

    Publication: 1370556;

  34. Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

    ID: 1466131

    Description: epitope description:TGIYQVPIFYTCTFTNITSCNSKPII antigen name:envelope polyprotein host organism:Equus caballus

    Publication: 1370556;

  35. Segregation of B and T cell epitopes of Treponema pallidum repeat protein K to variable and conserved regions during experimental syphilis infection.

    ID: 1466155

    Description: epitope description:VYAEINVKALKLSLESNGGA antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus New Zealand White antibody name:pooled rabbit...

    Publication: 12097401;

  36. Segregation of B and T cell epitopes of Treponema pallidum repeat protein K to variable and conserved regions during experimental syphilis infection.

    ID: 1466159

    Description: epitope description:TPSKYGLGGDILFGWERTRE antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus New Zealand White antibody name:pooled rabbit...

    Publication: 12097401;

  37. Segregation of B and T cell epitopes of Treponema pallidum repeat protein K to variable and conserved regions during experimental syphilis infection.

    ID: 1466175

    Description: epitope description:ELAWGIASDGGALKHGFKTT antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus New Zealand White antibody name:pooled rabbit...

    Publication: 12097401;

  38. Segregation of B and T cell epitopes of Treponema pallidum repeat protein K to variable and conserved regions during experimental syphilis infection.

    ID: 1466176

    Description: epitope description:FKIVFPIVAKKDFKYRGEGN antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus New Zealand White antibody name:pooled rabbit...

    Publication: 12097401;

  39. Antibodies raised against peptide fragments of bovine alpha s1-casein cross-react with the intact protein only when the peptides contain both B and T ...

    ID: 1466192

    Description: epitope description:RPKHPIKHQGLPQEVLNENL antigen name:Bos d 9 host organism:Mus musculus C3H/He antibody name:anti-alphas1-casein

    Publication: 1696355;

  40. Antibodies raised against peptide fragments of bovine alpha s1-casein cross-react with the intact protein only when the peptides contain both B and T ...

    ID: 1466200

    Description: epitope description:LNENLLRFFVAPFPQVFGKE antigen name:Bos d 9 host organism:Mus musculus C3H/He antibody name:anti-alphas1-casein

    Publication: 1696355;

  41. Antibodies raised against peptide fragments of bovine alpha s1-casein cross-react with the intact protein only when the peptides contain both B and T ...

    ID: 1466281

    Description: epitope description:SESTEDQAMEDIKQMEAESI antigen name:Bos d 9 host organism:Mus musculus C3H/He antibody name:anti-alphas1-casein

    Publication: 1696355;

  42. Antibodies raised against peptide fragments of bovine alpha s1-casein cross-react with the intact protein only when the peptides contain both B and T ...

    ID: 1466283

    Description: epitope description:SESTEDQAMEDIKQMEAESI antigen name:Bos d 9 host organism:Mus musculus C3H/He antibody name:anti-alphas1-casein (1-20)

    Publication: 1696355;

  43. Antibodies raised against peptide fragments of bovine alpha s1-casein cross-react with the intact protein only when the peptides contain both B and T ...

    ID: 1466292

    Description: epitope description:VEQKHIQKEDVPSERYLGYL antigen name:Bos d 9 host organism:Mus musculus C3H/He antibody name:anti-alphas1-casein

    Publication: 1696355;

  44. Antibodies raised against peptide fragments of bovine alpha s1-casein cross-react with the intact protein only when the peptides contain both B and T ...

    ID: 1466294

    Description: epitope description:VEQKHIQKEDVPSERYLGYL antigen name:Bos d 9 host organism:Mus musculus C3H/He antibody name:anti-alphas1-casein (1-20)

    Publication: 1696355;

  45. Antibodies raised against peptide fragments of bovine alpha s1-casein cross-react with the intact protein only when the peptides contain both B and T ...

    ID: 1466299

    Description: epitope description:YLGYLEQLLRLKKYKVPQLE antigen name:Bos d 9 host organism:Mus musculus C3H/He antibody name:anti-alphas1-casein

    Publication: 1696355;

  46. Antibodies raised against peptide fragments of bovine alpha s1-casein cross-react with the intact protein only when the peptides contain both B and T ...

    ID: 1466318

    Description: epitope description:IGVNQELAYFYPELFRQFYQ antigen name:Bos d 9 host organism:Mus musculus C3H/He antibody name:anti-alphas1-casein

    Publication: 1696355;

  47. Antibodies raised against peptide fragments of bovine alpha s1-casein cross-react with the intact protein only when the peptides contain both B and T ...

    ID: 1466325

    Description: epitope description:RQFYQLDAYPSGAWYYVPLG antigen name:Bos d 9 host organism:Mus musculus C3H/He antibody name:anti-alphas1-casein

    Publication: 1696355;

  48. Antibodies raised against peptide fragments of bovine alpha s1-casein cross-react with the intact protein only when the peptides contain both B and T ...

    ID: 1466328

    Description: epitope description:YVPLGTQYTDAPSFSDIPNP antigen name:Bos d 9 host organism:Mus musculus C3H/He antibody name:anti-alphas1-casein

    Publication: 1696355;

  49. Antibodies raised against peptide fragments of bovine alpha s1-casein cross-react with the intact protein only when the peptides contain both B and T ...

    ID: 1466331

    Description: epitope description:YVPLGTQYTDAPSFSDIPNP antigen name:Bos d 9 host organism:Mus musculus C3H/He antibody name:anti-alphas1-casein (1-20)

    Publication: 1696355;

  50. Antibodies raised against peptide fragments of bovine alpha s1-casein cross-react with the intact protein only when the peptides contain both B and T ...

    ID: 1466336

    Description: epitope description:DIPNPIGSENSEKTTMPLW antigen name:Bos d 9 host organism:Mus musculus C3H/He antibody name:anti-alphas1-casein

    Publication: 1696355;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston