Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Conformational and linear B-cell epitopes of Asp f 2, a major allergen of Aspergillus fumigatus, bind differently to immunoglobulin E antibody in the ...

    ID: 1644294

    Description: epitope description:DIAAPGVGCA antigen name:Asp f 2 host organism:Homo sapiens

    Publication: 10225885;

  2. Conformational and linear B-cell epitopes of Asp f 2, a major allergen of Aspergillus fumigatus, bind differently to immunoglobulin E antibody in the ...

    ID: 1644301

    Description: epitope description:GCAGESHGPD antigen name:Asp f 2 host organism:Homo sapiens

    Publication: 10225885;

  3. Conformational and linear B-cell epitopes of Asp f 2, a major allergen of Aspergillus fumigatus, bind differently to immunoglobulin E antibody in the ...

    ID: 1644303

    Description: epitope description:AGESHGPDQG antigen name:Asp f 2 host organism:Homo sapiens

    Publication: 10225885;

  4. Conformational and linear B-cell epitopes of Asp f 2, a major allergen of Aspergillus fumigatus, bind differently to immunoglobulin E antibody in the ...

    ID: 1644304

    Description: epitope description:GESHGPDQGH antigen name:Asp f 2 host organism:Homo sapiens

    Publication: 10225885;

  5. Conformational and linear B-cell epitopes of Asp f 2, a major allergen of Aspergillus fumigatus, bind differently to immunoglobulin E antibody in the ...

    ID: 1644309

    Description: epitope description:PDQGHDTGSA antigen name:Asp f 2 host organism:Homo sapiens

    Publication: 10225885;

  6. Conformational and linear B-cell epitopes of Asp f 2, a major allergen of Aspergillus fumigatus, bind differently to immunoglobulin E antibody in the ...

    ID: 1644313

    Description: epitope description:HDTGSASAPA antigen name:Asp f 2 host organism:Homo sapiens

    Publication: 10225885;

  7. Conformational and linear B-cell epitopes of Asp f 2, a major allergen of Aspergillus fumigatus, bind differently to immunoglobulin E antibody in the ...

    ID: 1644314

    Description: epitope description:DTGSASAPAS antigen name:Asp f 2 host organism:Homo sapiens

    Publication: 10225885;

  8. Conformational and linear B-cell epitopes of Asp f 2, a major allergen of Aspergillus fumigatus, bind differently to immunoglobulin E antibody in the ...

    ID: 1644316

    Description: epitope description:GSASAPASTS antigen name:Asp f 2 host organism:Homo sapiens

    Publication: 10225885;

  9. Conformational and linear B-cell epitopes of Asp f 2, a major allergen of Aspergillus fumigatus, bind differently to immunoglobulin E antibody in the ...

    ID: 1644319

    Description: epitope description:SAPASTSTSS antigen name:Asp f 2 host organism:Homo sapiens

    Publication: 10225885;

  10. Conformational and linear B-cell epitopes of Asp f 2, a major allergen of Aspergillus fumigatus, bind differently to immunoglobulin E antibody in the ...

    ID: 1644334

    Description: epitope description:SGSGATTTPT antigen name:Asp f 2 host organism:Homo sapiens

    Publication: 10225885;

  11. Conformational and linear B-cell epitopes of Asp f 2, a major allergen of Aspergillus fumigatus, bind differently to immunoglobulin E antibody in the ...

    ID: 1644336

    Description: epitope description:SGATTTPTDS antigen name:Asp f 2 host organism:Homo sapiens

    Publication: 10225885;

  12. Conformational and linear B-cell epitopes of Asp f 2, a major allergen of Aspergillus fumigatus, bind differently to immunoglobulin E antibody in the ...

    ID: 1644342

    Description: epitope description:PTDSPSATID antigen name:Asp f 2 host organism:Homo sapiens

    Publication: 10225885;

  13. Conformational and linear B-cell epitopes of Asp f 2, a major allergen of Aspergillus fumigatus, bind differently to immunoglobulin E antibody in the ...

    ID: 1644343

    Description: epitope description:TDSPSATIDV antigen name:Asp f 2 host organism:Homo sapiens

    Publication: 10225885;

  14. Conformational and linear B-cell epitopes of Asp f 2, a major allergen of Aspergillus fumigatus, bind differently to immunoglobulin E antibody in the ...

    ID: 1644348

    Description: epitope description:ATIDVPSNCH antigen name:Asp f 2 host organism:Homo sapiens

    Publication: 10225885;

  15. Conformational and linear B-cell epitopes of Asp f 2, a major allergen of Aspergillus fumigatus, bind differently to immunoglobulin E antibody in the ...

    ID: 1644355

    Description: epitope description:NCHTHEGGQL antigen name:Asp f 2 host organism:Homo sapiens

    Publication: 10225885;

  16. Conformational and linear B-cell epitopes of Asp f 2, a major allergen of Aspergillus fumigatus, bind differently to immunoglobulin E antibody in the ...

    ID: 1644361

    Description: epitope description:YTTRR antigen name:Asp f 2 host organism:Homo sapiens

    Publication: 10225885;

  17. Direct in vivo intracellular selection of conformation-sensitive antibody domains targeting Alzheimer's amyloid-beta oligomers.

    ID: 1644381

    Description: epitope description:DAEFRHDSGY antigen name:Amyloid beta A4 protein host organism:Mus musculus BALB/c antibody name:B2

    Publication: 19361429;

  18. CD40L disruption enhances Abeta vaccine-mediated reduction of cerebral amyloidosis while minimizing cerebral amyloid angiopathy and inflammation.

    ID: 1644647

    Description: epitope description:LVFFAEDV antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:4G8

    Publication: 18055209;

  19. Goodpasture syndrome. Localization of the epitope for the autoantibodies to the carboxyl-terminal region of the alpha 3(IV) chain of basement membrane...

    ID: 1644693

    Description: epitope description:SLNPERMFRKP antigen name:Collagen alpha-3(IV) chain host organism:Homo sapiens

    Publication: 1721062;

  20. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653252

    Description: epitope description:RGEPGTPG antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  21. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653263

    Description: epitope description:PAGAAGNP antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  22. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653265

    Description: epitope description:GAAGNPGT antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  23. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653266

    Description: epitope description:AAGNPGTD antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  24. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653280

    Description: epitope description:GSAGAPGI antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  25. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653282

    Description: epitope description:AGAPGIAG antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  26. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653283

    Description: epitope description:GAPGIAGA antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  27. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653285

    Description: epitope description:PGIAGAPG antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  28. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653298

    Description: epitope description:GPPGPTGA antigen name:Collagen alpha-1(II) chain host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  29. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653301

    Description: epitope description:GPTGASGP antigen name:Collagen alpha-1(II) chain host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  30. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653302

    Description: epitope description:PTGASGPL antigen name:Collagen alpha-1(II) chain host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  31. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653304

    Description: epitope description:GASGPLGP antigen name:Collagen alpha-1(II) chain host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  32. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653306

    Description: epitope description:SGPLGPKG antigen name:Collagen alpha-1(II) chain host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  33. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653312

    Description: epitope description:KGQTGEPG antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  34. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653313

    Description: epitope description:GQTGEPGI antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  35. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653314

    Description: epitope description:QTGEPGIA antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  36. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653316

    Description: epitope description:GEPGIAGF antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  37. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653321

    Description: epitope description:AGFKGEQG antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  38. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653322

    Description: epitope description:GFKGEQGP antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  39. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653337

    Description: epitope description:GVQGAPGP antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  40. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653342

    Description: epitope description:PGPAGEEG antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  41. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653356

    Description: epitope description:EPGGAGPA antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  42. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653365

    Description: epitope description:PPGERGAP antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  43. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653372

    Description: epitope description:PGSRGFPG antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  44. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653373

    Description: epitope description:GSRGFPGQ antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  45. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653382

    Description: epitope description:GIAGPKGP antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  46. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653387

    Description: epitope description:KGPPGERG antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  47. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653388

    Description: epitope description:GPPGERGS antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  48. Identification of antibody epitopes within the CB-11 peptide of type II collagen. I: Detection of antibody binding sites by epitope scanning.

    ID: 1653393

    Description: epitope description:RGSPGAVG antigen name:Other Bos taurus (domestic cow) protein host organism:Rattus norvegicus Wistar

    Publication: 1721846;

  49. Identification of functional epitopes of Pseudomonas aeruginosa exotoxin A using synthetic peptides and subclone products.

    ID: 1709640

    Description: epitope description:AEEAFDLWNECAKACVLDLKDGVRSSRMSV antigen name:Exotoxin A host organism:Rattus norvegicus Sprague-Dawley

    Publication: 1700288;

  50. Identification of functional epitopes of Pseudomonas aeruginosa exotoxin A using synthetic peptides and subclone products.

    ID: 1709661

    Description: epitope description:DLDPSSIPDKEQAISALPDYASQPGKPPREDLK antigen name:Exotoxin A host organism:Rattus norvegicus Sprague-Dawley

    Publication: 1700288;

  51. Superiority of thyroid peroxidase DNA over protein immunization in replicating human thyroid autoimmunity in HLA-DRB1*0301 (DR3) transgenic mice.

    ID: 1709695

    Description: epitope description:GLPRLETPADLSTAIASRS antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Mus musculus NOD HLA-DR3 Tg IAbeta null

    Publication: 15320899;

  52. Identification of an immunodominant region recognized by human autoantibodies in a three-dimensional model of thyroid peroxidase.

    ID: 1709798

    Description: epitope description:DLSTAIASRSVADKILDLY antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 10830285;

  53. Identification of an immunodominant region recognized by human autoantibodies in a three-dimensional model of thyroid peroxidase.

    ID: 1709799

    Description: epitope description:PRGWNPGFLYNGFPL antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 10830285;

  54. Identification of an immunodominant region recognized by human autoantibodies in a three-dimensional model of thyroid peroxidase.

    ID: 1709801

    Description: epitope description:RWLPPVYEDGFS antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 10830285;

  55. Identification of an immunodominant region recognized by human autoantibodies in a three-dimensional model of thyroid peroxidase.

    ID: 1709808

    Description: epitope description:LQVQDQLMNEELTER antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 10830285;

  56. Immunogenicity of a unique region of the human thyrotropin receptor.

    ID: 1709825

    Description: epitope description:YYVFFEEQEDEIIGFG antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7901266;

  57. Immunogenicity of a unique region of the human thyrotropin receptor.

    ID: 1709826

    Description: epitope description:TLQAFDSHYDYTICGDNEDMV antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7901266;

  58. Evaluation of conformational epitopes on thyroid peroxidase by antipeptide antibody binding and mutagenesis.

    ID: 1709967

    Description: epitope description:RDYIPRILGPEAFQQYVGP antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15030525;

  59. Evaluation of conformational epitopes on thyroid peroxidase by antipeptide antibody binding and mutagenesis.

    ID: 1709970

    Description: epitope description:PGLWLHQAFFSPWTLLR antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15030525;

  60. Evaluation of conformational epitopes on thyroid peroxidase by antipeptide antibody binding and mutagenesis.

    ID: 1709972

    Description: epitope description:VADKILDLYKHPDNIDVWL antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15030525;

  61. Evaluation of conformational epitopes on thyroid peroxidase by antipeptide antibody binding and mutagenesis.

    ID: 1709977

    Description: epitope description:TDAQRRELEKHSLSRVIC antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15030525;

  62. Evaluation of conformational epitopes on thyroid peroxidase by antipeptide antibody binding and mutagenesis.

    ID: 1709981

    Description: epitope description:GPYEGYDSTA antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15030525;

  63. Evaluation of conformational epitopes on thyroid peroxidase by antipeptide antibody binding and mutagenesis.

    ID: 1709988

    Description: epitope description:EAFQQYVGPYEGYDST antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15030525;

  64. Evaluation of conformational epitopes on thyroid peroxidase by antipeptide antibody binding and mutagenesis.

    ID: 1709989

    Description: epitope description:EAFQQYVGPYEGYDST antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15030525;

  65. Evaluation of conformational epitopes on thyroid peroxidase by antipeptide antibody binding and mutagenesis.

    ID: 1709992

    Description: epitope description:NFLPRARTG antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15030525;

  66. Evaluation of conformational epitopes on thyroid peroxidase by antipeptide antibody binding and mutagenesis.

    ID: 1709995

    Description: epitope description:TRVPMDAFQVGKFPEDFESC antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15030525;

  67. Evaluation of conformational epitopes on thyroid peroxidase by antipeptide antibody binding and mutagenesis.

    ID: 1709996

    Description: epitope description:RLDASFQEHPDLPG antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15030525;

  68. Evaluation of conformational epitopes on thyroid peroxidase by antipeptide antibody binding and mutagenesis.

    ID: 1709999

    Description: epitope description:LQVQDQLMNEELTER antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15030525;

  69. Evaluation of conformational epitopes on thyroid peroxidase by antipeptide antibody binding and mutagenesis.

    ID: 1710001

    Description: epitope description:GLPRLETPADLSTAIASRS antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15030525;

  70. Evaluation of conformational epitopes on thyroid peroxidase by antipeptide antibody binding and mutagenesis.

    ID: 1710008

    Description: epitope description:GLPRLETPADLSTAIASRS antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Homo sapiens

    Publication: 15030525;

  71. Antisera to synthetic peptides of lens MIP26K (major intrinsic polypeptide): characterization and use as site-specific probes of membrane changes in t...

    ID: 1710019

    Description: epitope description:TGEPVELK antigen name:Lens fiber major intrinsic protein host organism:Oryctolagus cuniculus

    Publication: 2415383;

  72. Analysis of B cell epitopes of a glycoprotein porcine zona pellucida (pZP1).

    ID: 1710028

    Description: epitope description:LDPENLTL antigen name:Zona pellucida sperm-binding protein 2 host organism:Mus musculus BALB/c antibody name:5H4

    Publication: 10924748;

  73. Analysis of B cell epitopes of a glycoprotein porcine zona pellucida (pZP1).

    ID: 1710030

    Description: epitope description:LDPENLTL antigen name:Zona pellucida sperm-binding protein 2 host organism:Mus musculus BALB/c antibody name:5H4

    Publication: 10924748;

  74. High plasma concentrations of autoantibodies against native peptide 210 of apoB-100 are related to less coronary atherosclerosis and lower risk of myo...

    ID: 1710154

    Description: epitope description:IEIGLEGKGFEPTLEALFGK antigen name:Apolipoprotein B-100 host organism:Homo sapiens

    Publication: 18664466;

  75. High plasma concentrations of autoantibodies against native peptide 210 of apoB-100 are related to less coronary atherosclerosis and lower risk of myo...

    ID: 1710156

    Description: epitope description:IEIGLEGKGFEPTLEALFGK antigen name:Apolipoprotein B-100 host organism:Homo sapiens

    Publication: 18664466;

  76. High plasma concentrations of autoantibodies against native peptide 210 of apoB-100 are related to less coronary atherosclerosis and lower risk of myo...

    ID: 1710161

    Description: epitope description:KTTKQSFDLSVKAQYKKNKH antigen name:Apolipoprotein B-100 host organism:Homo sapiens

    Publication: 18664466;

  77. Flow cytometric analyses of antibody binding to Chinese hamster ovary cells expressing human thyrotropin receptor.

    ID: 1710166

    Description: epitope description:EEQEDEIIGFGQELKN antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9177401;

  78. Impact of feline zona pellucida glycoprotein B-derived synthetic peptides on in vitro fertilization of cat oocytes.

    ID: 1710447

    Description: epitope description:VEGTDAAGRRVTNTKVLRCP antigen name:Zona pellucida sperm-binding protein 4 host organism:Oryctolagus cuniculus

    Publication: 15056783;

  79. Interaction of BP180 (type XVII collagen) and alpha6 integrin is necessary for stabilization of hemidesmosome structure.

    ID: 1710573

    Description: epitope description:RSILPYGDSMDRIE antigen name:Collagen alpha-1(XVII) chain host organism:Oryctolagus cuniculus

    Publication: 9856810;

  80. Immunocontraceptive efficacy of synthetic peptides corresponding to major antigenic determinants of chicken riboflavin carrier protein in the female r...

    ID: 1710574

    Description: epitope description:CEDFTKKIEAFYRASPHAAR host organism:Rattus norvegicus Wistar

    Publication: 11028906;

  81. Immunocontraceptive efficacy of synthetic peptides corresponding to major antigenic determinants of chicken riboflavin carrier protein in the female r...

    ID: 1710575

    Description: epitope description:CEDFTKKIEAFYRASPHAAR host organism:Rattus norvegicus Wistar

    Publication: 11028906;

  82. Immunocontraceptive efficacy of synthetic peptides corresponding to major antigenic determinants of chicken riboflavin carrier protein in the female r...

    ID: 1710577

    Description: epitope description:CEDFTKKIEAFYRASPHAAR host organism:Rattus norvegicus Wistar

    Publication: 11028906;

  83. Immunocontraceptive efficacy of synthetic peptides corresponding to major antigenic determinants of chicken riboflavin carrier protein in the female r...

    ID: 1710578

    Description: epitope description:CEDFTKKIEAFYRASPHAAR host organism:Oryctolagus cuniculus albino

    Publication: 11028906;

  84. A zona pellucida 3 peptide vaccine induces antibodies and reversible infertility without ovarian pathology.

    ID: 1710607

    Description: epitope description:NSSSSQFQIHGPR antigen name:Zona pellucida sperm-binding protein 3 host organism:Mus musculus A/J

    Publication: 7650399;

  85. Rabbit antibodies toward extracellular loops of the membrane spanning region of human thyrotropin receptor possess thyroid stimulating activities.

    ID: 1710611

    Description: epitope description:HSEYYNHAIDWQTGPGCNTA antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus antibody name:anti-E1

    Publication: 1764054;

  86. Prokaryotic expression of the thyrotropin receptor and identification of an immunogenic region of the protein using synthetic peptides.

    ID: 1710619

    Description: epitope description:YYVFFEEQEDEIIGF antigen name:Thyrotropin receptor host organism:Homo sapiens

    Publication: 1883361;

  87. Prokaryotic expression of the thyrotropin receptor and identification of an immunogenic region of the protein using synthetic peptides.

    ID: 1710620

    Description: epitope description:EEQEDEIIGFGQELKN antigen name:Thyrotropin receptor host organism:Homo sapiens

    Publication: 1883361;

  88. Prokaryotic expression of the thyrotropin receptor and identification of an immunogenic region of the protein using synthetic peptides.

    ID: 1710622

    Description: epitope description:PQEETLQAFDSHYDYT antigen name:Thyrotropin receptor host organism:Homo sapiens

    Publication: 1883361;

  89. Sera of children with hepatitis C infection and anti-liver-kidney microsome-1 antibodies recognize different CYP2D6 epitopes than adults with LKM+/HCV...

    ID: 1710653

    Description: epitope description:LLTEHRMTWDPAQPPRDL antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 10554122;

  90. Sera of children with hepatitis C infection and anti-liver-kidney microsome-1 antibodies recognize different CYP2D6 epitopes than adults with LKM+/HCV...

    ID: 1710656

    Description: epitope description:EKPFRFHPEHFLDAQGHFVK antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 10554122;

  91. Prokaryotic expression of the thyrotropin receptor and identification of an immunogenic region of the protein using synthetic peptides.

    ID: 1710666

    Description: epitope description:TLQAFDSHYDYTICGDSKDMV antigen name:Thyrotropin receptor host organism:Homo sapiens

    Publication: 1883361;

  92. Efficacy of antibodies against a chimeric synthetic peptide encompassing epitopes of bonnet monkey (Macaca radiata) zona pellucida-1 and zona pellucid...

    ID: 1710673

    Description: epitope description:DRAVYENELVATRDVKNGSRGSV antigen name:Glycoprotein zona pellucida-1 host organism:Macaca radiata

    Publication: 15625695;

  93. Efficacy of antibodies against a chimeric synthetic peptide encompassing epitopes of bonnet monkey (Macaca radiata) zona pellucida-1 and zona pellucid...

    ID: 1710700

    Description: epitope description:DRAVYENELVATRDVKNGSRGSVGGGKGDCGTPSHSRRQPHVVSQWSRSA host organism:Mus musculus BALB/c

    Publication: 15625695;

  94. Cytotoxic mAb from rheumatic carditis recognizes heart valves and laminin.

    ID: 1710703

    Description: epitope description:SERVQLLHSQNTSLINQK antigen name:Myosin-7 host organism:Homo sapiens antibody name:mAb 3.B6

    Publication: 10903337;

  95. Cytotoxic mAb from rheumatic carditis recognizes heart valves and laminin.

    ID: 1710706

    Description: epitope description:KEALISSLTRGKLTYTQQ antigen name:Other Homo sapiens (human) protein host organism:Homo sapiens antibody name:mAb 3.B6

    Publication: 10903337;

  96. Cytotoxic mAb from rheumatic carditis recognizes heart valves and laminin.

    ID: 1710720

    Description: epitope description:SERVQLLHSQNTSLINQK antigen name:Myosin-7 host organism:Homo sapiens antibody name:mAb 3.B6

    Publication: 10903337;

  97. Cytotoxic mAb from rheumatic carditis recognizes heart valves and laminin.

    ID: 1710721

    Description: epitope description:NKNLQEEISDLTEQLGSS antigen name:Myosin-7 host organism:Homo sapiens antibody name:mAb 3.B6

    Publication: 10903337;

  98. Immunogenicity evaluation of a lipidic amino acid-based synthetic peptide vaccine for Chlamydia trachomatis.

    ID: 1710724

    Description: epitope description:AETIFD antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10 X DBA/2

    Publication: 7690812;

  99. Immunogenicity evaluation of a lipidic amino acid-based synthetic peptide vaccine for Chlamydia trachomatis.

    ID: 1710727

    Description: epitope description:TIFDVT antigen name:Major outer membrane porin, serovar D host organism:Mus musculus B10.BR

    Publication: 7690812;

  100. Cytotoxic mAb from rheumatic carditis recognizes heart valves and laminin.

    ID: 1710733

    Description: epitope description:KEALISSLTRGKLTYTQQ antigen name:Other Homo sapiens (human) protein host organism:Homo sapiens antibody name:mAb 3.B6

    Publication: 10903337;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston