Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Studies on a species-specific epitope in murine, ovine and bovine prion protein.

    ID: 1280363

    Description: epitope description:WGQGGTHGQWNKPSK antigen name:Major prion protein host organism:Oryctolagus cuniculus Chinchilla antibody name:RaIV/2

    Publication: 7687651;

  2. Studies on a species-specific epitope in murine, ovine and bovine prion protein.

    ID: 1280368

    Description: epitope description:MERVVEQMCVTQYQKESQAY antigen name:Major prion protein host organism:Oryctolagus cuniculus Chinchilla antibody name:Ra7

    Publication: 7687651;

  3. Artificial mosaic protein containing antigenic epitopes of hepatitis E virus.

    ID: 1280413

    Description: epitope description:DYDNQHEQDRPTPSPAPSR antigen name:Capsid protein host organism:Cavia porcellus

    Publication: 7523696;

  4. Artificial mosaic protein containing antigenic epitopes of hepatitis E virus.

    ID: 1280417

    Description: epitope description:PSAPPLPPVADLPQPGLRR antigen name:Protein ORF3 host organism:Cavia porcellus

    Publication: 7523696;

  5. Artificial mosaic protein containing antigenic epitopes of hepatitis E virus.

    ID: 1280428

    Description: epitope description:ANPPDHSAPLGVTRPSAPPL antigen name:Protein ORF3 host organism:Cavia porcellus

    Publication: 7523696;

  6. Artificial mosaic protein containing antigenic epitopes of hepatitis E virus.

    ID: 1280443

    Description: epitope description:ANQPGHLAPLGEIRPSAPPL antigen name:Protein ORF3 host organism:Cavia porcellus

    Publication: 7523696;

  7. Artificial mosaic protein containing antigenic epitopes of hepatitis E virus.

    ID: 1280444

    Description: epitope description:ANQPGHLAPLGEIRPSAPPL antigen name:Protein ORF3 host organism:Cavia porcellus

    Publication: 7523696;

  8. Studies on a species-specific epitope in murine, ovine and bovine prion protein.

    ID: 1280448

    Description: epitope description:WGQGGTHGQWNKPSK antigen name:Major prion protein host organism:Oryctolagus cuniculus Chinchilla antibody name:RaIV/2

    Publication: 7687651;

  9. Mimicry between the hepatitis C virus polyprotein and antigenic targets of nuclear and smooth muscle antibodies in chronic hepatitis C virus infection...

    ID: 1280461

    Description: epitope description:KNQVEGEVQIVSTATQTFLA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 12930368;

  10. Mimicry between the hepatitis C virus polyprotein and antigenic targets of nuclear and smooth muscle antibodies in chronic hepatitis C virus infection...

    ID: 1280463

    Description: epitope description:VARALAHGVRVLEDGVNFAT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 12930368;

  11. Mimicry between the hepatitis C virus polyprotein and antigenic targets of nuclear and smooth muscle antibodies in chronic hepatitis C virus infection...

    ID: 1280465

    Description: epitope description:LLISQAEAALENLVILNAAS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 12930368;

  12. Mimicry between the hepatitis C virus polyprotein and antigenic targets of nuclear and smooth muscle antibodies in chronic hepatitis C virus infection...

    ID: 1281721

    Description: epitope description:RLRSSVPGVRLLQDSVDFSL antigen name:Vimentin host organism:Homo sapiens

    Publication: 12930368;

  13. Mimicry between the hepatitis C virus polyprotein and antigenic targets of nuclear and smooth muscle antibodies in chronic hepatitis C virus infection...

    ID: 1281727

    Description: epitope description:ELDQENEAALENGIKNEENT antigen name:Matrin-3 (UniProt:P43243) host organism:Homo sapiens

    Publication: 12930368;

  14. Mimicry between the hepatitis C virus polyprotein and antigenic targets of nuclear and smooth muscle antibodies in chronic hepatitis C virus infection...

    ID: 1281730

    Description: epitope description:VARALAHGVRVLEDGVNFAT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 12930368;

  15. Mimicry between the hepatitis C virus polyprotein and antigenic targets of nuclear and smooth muscle antibodies in chronic hepatitis C virus infection...

    ID: 1281737

    Description: epitope description:RLRSSVPGVRLLQDSVDFSL antigen name:Vimentin host organism:Homo sapiens

    Publication: 12930368;

  16. Antigenic regions within the hepatitis C virus envelope 1 and non-structural proteins: identification of an IgG3-restricted recognition site with the ...

    ID: 1281747

    Description: epitope description:TPGCVPCVREGNASRCWV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7680297;

  17. Antigenic regions within the hepatitis C virus envelope 1 and non-structural proteins: identification of an IgG3-restricted recognition site with the ...

    ID: 1281749

    Description: epitope description:TPTVATRDGKLPATQLRR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7680297;

  18. Antigenic regions within the hepatitis C virus envelope 1 and non-structural proteins: identification of an IgG3-restricted recognition site with the ...

    ID: 1281753

    Description: epitope description:SVFLVGQLFTFSPRRHWT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7680297;

  19. Antigenic regions within the hepatitis C virus envelope 1 and non-structural proteins: identification of an IgG3-restricted recognition site with the ...

    ID: 1281758

    Description: epitope description:VMAQLLRIPQAILDMIAG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7680297;

  20. Antigenic regions within the hepatitis C virus envelope 1 and non-structural proteins: identification of an IgG3-restricted recognition site with the ...

    ID: 1281759

    Description: epitope description:AILDMIAGAHWGVLAGIA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7680297;

  21. Antigenic regions within the hepatitis C virus envelope 1 and non-structural proteins: identification of an IgG3-restricted recognition site with the ...

    ID: 1281763

    Description: epitope description:GVDAETHVTGGSAGHTVS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7680297;

  22. Antigenic regions within the hepatitis C virus envelope 1 and non-structural proteins: identification of an IgG3-restricted recognition site with the ...

    ID: 1281771

    Description: epitope description:DLEDRDRSELSPLLLTTT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7680297;

  23. Sequence variation within botulinum neurotoxin serotypes impacts antibody binding and neutralization.

    ID: 1281788

    Description: epitope description:RLLSTFTEYIKNIINTSILNLRYESNHLIDLSRYASKINIGSKVNFDPIDKNQIQLFNLESSKIEVILKNAIVYNSMYENFSTSFWIRIPKYFNSISLNNEYTIINCMENNSGWKVSLNYGEIIWTLQDT...

    Publication: 16113261;

  24. HCV-NS3 and IgG-Fc crossreactive IgM in patients with type II mixed cryoglobulinemia and B-cell clonal proliferations.

    ID: 1281794

    Description: epitope description:VLVLNPSVAATLGFGAYMSK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 16617326;

  25. Sequence variation within botulinum neurotoxin serotypes impacts antibody binding and neutralization.

    ID: 1281801

    Description: epitope description:RLLSTFTEYIKNIINTSILNLRYESNHLIDLSRYASKINIGSKVNFDPIDKNQIQLFNLESSKIEVILKNAIVYNSMYENFSTSFWIRIPKYFNSISLNNEYTIINCMENNSGWKVSLNYGEIIWTLQDT...

    Publication: 16113261;

  26. Sequence variation within botulinum neurotoxin serotypes impacts antibody binding and neutralization.

    ID: 1281805

    Description: epitope description:ALNDLCIKVNNWDLFFSPSEDNFTNDLNKGEEITSDTNIEAAEENISLDLIQQYYLTFNFDNEPENISIENLSSDIIGQLELMPNIERFPNGKKYELDKYTMFHYLRAQEFEHGKSRIALTNSVNEALLN...

    Publication: 16113261;

  27. Sequence variation within botulinum neurotoxin serotypes impacts antibody binding and neutralization.

    ID: 1281807

    Description: epitope description:ALNDLCIKVNNWDLFFSPSEDNFTNDLNKGEEITSDTNIEAAEENISLDLIQQYYLTFNFDNEPENISIENLSSDIIGQLELMPNIERFPNGKKYELDKYTMFHYLRAQEFEHGKSRIALTNSVNEALLN...

    Publication: 16113261;

  28. Sequence variation within botulinum neurotoxin serotypes impacts antibody binding and neutralization.

    ID: 1281809

    Description: epitope description:ALNDLCIKVNNWDLFFSPSEDNFTNDLNKGEEITSDTNIEAAEENISLDLIQQYYLTFNFDNEPENISIENLSSDIIGQLELMPNIERFPNGKKYELDKYTMFHYLRAQEFEHGKSRIALTNSVNEALLN...

    Publication: 16113261;

  29. Sequence variation within botulinum neurotoxin serotypes impacts antibody binding and neutralization.

    ID: 1281811

    Description: epitope description:PFVNKQFNYKDPVNGVDIAYIKIPNVGQMQPVKAFKIHNKIWVIPERDTFTNPEEGDLNPPPEAKQVPVSYYDSTYLSTDNEKDNYLKGVTKLFERIYSTDLGRMLLTSIVRGIPFWGGSTIDTELKVID...

    Publication: 16113261;

  30. Sequence variation within botulinum neurotoxin serotypes impacts antibody binding and neutralization.

    ID: 1281814

    Description: epitope description:PFVNKQFNYKDPVNGVDIAYIKIPNVGQMQPVKAFKIHNKIWVIPERDTFTNPEEGDLNPPPEAKQVPVSYYDSTYLSTDNEKDNYLKGVTKLFERIYSTDLGRMLLTSIVRGIPFWGGSTIDTELKVID...

    Publication: 16113261;

  31. Antigenic regions within the hepatitis C virus envelope 1 and non-structural proteins: identification of an IgG3-restricted recognition site with the ...

    ID: 1281821

    Description: epitope description:IIPDREVLYREFDEMEEC antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7680297;

  32. Antigenic regions within the hepatitis C virus envelope 1 and non-structural proteins: identification of an IgG3-restricted recognition site with the ...

    ID: 1281833

    Description: epitope description:NKRNTNRRPQDVKFPGGG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7680297;

  33. Antigenic regions within the hepatitis C virus envelope 1 and non-structural proteins: identification of an IgG3-restricted recognition site with the ...

    ID: 1281835

    Description: epitope description:KTSERSQPRGRRQPIPKA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7680297;

  34. HCV-NS3 and IgG-Fc crossreactive IgM in patients with type II mixed cryoglobulinemia and B-cell clonal proliferations.

    ID: 1281845

    Description: epitope description:AIPLEVIK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 16617326;

  35. Bacterial cell surface display for epitope mapping of hepatitis C virus core antigen.

    ID: 1281848

    Description: epitope description:MSTNPKPQRKTKRNTNRRPQDVKFPG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 14553932;

  36. Identification of hepatitis C virus 1b-derived peptides recognized by both cellular and humoral immune systems in HCV1b(+) HLA-A24(+) patients.

    ID: 1286457

    Description: epitope description:AFYGVWPLL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 16095964;

  37. Identification of hepatitis C virus 1b-derived peptides recognized by both cellular and humoral immune systems in HCV1b(+) HLA-A24(+) patients.

    ID: 1286459

    Description: epitope description:LYGVWPLLL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 16095964;

  38. Identification of hepatitis C virus 1b-derived peptides recognized by both cellular and humoral immune systems in HCV1b(+) HLA-A24(+) patients.

    ID: 1286466

    Description: epitope description:TYVYDHLTPL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 16095964;

  39. Identification of hepatitis C virus 1b-derived peptides recognized by both cellular and humoral immune systems in HCV1b(+) HLA-A24(+) patients.

    ID: 1286472

    Description: epitope description:AYAAQGYKVL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 16095964;

  40. Identification of hepatitis C virus 1b-derived peptides recognized by both cellular and humoral immune systems in HCV1b(+) HLA-A24(+) patients.

    ID: 1286476

    Description: epitope description:EFWESVFTGL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 16095964;

  41. Identification of hepatitis C virus 1b-derived peptides recognized by both cellular and humoral immune systems in HCV1b(+) HLA-A24(+) patients.

    ID: 1286477

    Description: epitope description:QFKQKAIGL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 16095964;

  42. Identification of hepatitis C virus 1b-derived peptides recognized by both cellular and humoral immune systems in HCV1b(+) HLA-A24(+) patients.

    ID: 1286639

    Description: epitope description:PYIEQGMQL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 16095964;

  43. Isolation and characterization of monoclonal antibodies that inhibit hepatitis C virus NS3 protease.

    ID: 1288864

    Description: epitope description:DQDLV antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:8D4

    Publication: 10864639;

  44. Molecular specificities of antibodies against ovine and murine recombinant prion proteins.

    ID: 1288967

    Description: epitope description:THSQWNKPSKPKTNMK antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:8G8

    Publication: 11178966;

  45. Molecular specificities of antibodies against ovine and murine recombinant prion proteins.

    ID: 1288970

    Description: epitope description:GSDYEDRYYRENMHRYPNQ antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:12F10

    Publication: 11178966;

  46. Molecular specificities of antibodies against ovine and murine recombinant prion proteins.

    ID: 1288972

    Description: epitope description:CITQYERESQAYYQRGS antigen name:Major prion protein host organism:Mus musculus Biozzi antibody name:Pri 917

    Publication: 11178966;

  47. A monoclonal antibody to Bacillus anthracis protective antigen defines a neutralizing epitope in domain 1.

    ID: 1289281

    Description: epitope description:EVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELENIPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKGRLYQIKIQYQRENPTEKGL...

    Publication: 16790789;

  48. Molecular specificities of antibodies against ovine and murine recombinant prion proteins.

    ID: 1289286

    Description: epitope description:THGQWNKPSKPKTNMK antigen name:Major prion protein host organism:Oryctolagus cuniculus antibody name:RB1

    Publication: 11178966;

  49. Molecular specificities of antibodies against ovine and murine recombinant prion proteins.

    ID: 1289289

    Description: epitope description:THNQWNKPSKPKTNLK antigen name:Major prion protein host organism:Oryctolagus cuniculus antibody name:RM1

    Publication: 11178966;

  50. Molecular specificities of antibodies against ovine and murine recombinant prion proteins.

    ID: 1289298

    Description: epitope description:GGWGQPHGGGWGQG antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:SAF 15

    Publication: 11178966;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston