Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Peptide based vaccine design: synthesis and immunological characterization of branched polypeptide conjugates comprising the 276-284 immunodominant ep...

    ID: 1382658

    Description: epitope description:LEDPVG antigen name:Envelope glycoprotein D host organism:Mus musculus C57BL/6

    Publication: 11931583;

  2. Peptide based vaccine design: synthesis and immunological characterization of branched polypeptide conjugates comprising the 276-284 immunodominant ep...

    ID: 1382659

    Description: epitope description:SALLED antigen name:Envelope glycoprotein D host organism:Mus musculus BALB/c

    Publication: 11931583;

  3. Peptide based vaccine design: synthesis and immunological characterization of branched polypeptide conjugates comprising the 276-284 immunodominant ep...

    ID: 1382661

    Description: epitope description:SALLED antigen name:Envelope glycoprotein D host organism:Mus musculus C57BL/6

    Publication: 11931583;

  4. Exploring antibody polyspecificity using synthetic combinatorial libraries.

    ID: 1382696

    Description: epitope description:SSTSYNRGDSTFESK antigen name:Fibrinogen alpha chain host organism:Mus musculus antibody name:LJ-134B29

    Publication: 9238630;

  5. Exploring antibody polyspecificity using synthetic combinatorial libraries.

    ID: 1382705

    Description: epitope description:LHNNEAGRTTVFS antigen name:Proto-oncogene Wnt-1 host organism:Mus musculus antibody name:222-35C8

    Publication: 9238630;

  6. Discrimination of hepatitis B virus (HBV) subtypes using monoclonal antibodies to the PreS1 and PreS2 domains of the viral envelope.

    ID: 1382732

    Description: epitope description:MQWNSTAFHQTLQDPRVRGLYLPAGG antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:50-80, 116-183, 55-...

    Publication: 1693248;

  7. Discrimination of hepatitis B virus (HBV) subtypes using monoclonal antibodies to the PreS1 and PreS2 domains of the viral envelope.

    ID: 1382794

    Description: epitope description:TVNPVLTTASPLSSIFSRIGDPALN antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:128-603

    Publication: 1693248;

  8. Liposome-entrapped T-cell peptide provides help for a co-entrapped B-cell peptide to overcome genetic restriction in mice and induce immunological mem...

    ID: 1382990

    Description: epitope description:NLSVPNPLGFLPDHQLDPAFGANSTNPWDFNPC antigen name:Large envelope protein host organism:Mus musculus SJL

    Publication: 7508417;

  9. Differential host-dependent expression of alpha-galactosyl epitopes on viral glycoproteins: a study of eastern equine encephalitis virus as a model.

    ID: 1383000

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group antigen name:N-glycan host organism:Homo sapiens

    Publication: 7513744;

  10. Epitope mapping of a single repetitive unit of the B13 Trypanosoma cruzi antigen as fusions to Escherichia coli LamB protein.

    ID: 1409464

    Description: epitope description:FGQAAAGDKPSP antigen name:Surface antigen 2 (CA-2), putative host organism:Oryctolagus cuniculus New Zealand White antibody name:R...

    Publication: 15183869;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston