Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Mapping of serotype-specific, immunodominant epitopes in the NS-4 region of hepatitis C virus (HCV): use of type-specific peptides to serologically di...

    ID: 1289311

    Description: epitope description:SGKPAIIPD antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7686182;

  2. Mapping of serotype-specific, immunodominant epitopes in the NS-4 region of hepatitis C virus (HCV): use of type-specific peptides to serologically di...

    ID: 1289319

    Description: epitope description:DREVLYREF antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7686182;

  3. Mapping of serotype-specific, immunodominant epitopes in the NS-4 region of hepatitis C virus (HCV): use of type-specific peptides to serologically di...

    ID: 1289325

    Description: epitope description:REFDEMEEC antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7686182;

  4. Mapping of serotype-specific, immunodominant epitopes in the NS-4 region of hepatitis C virus (HCV): use of type-specific peptides to serologically di...

    ID: 1289326

    Description: epitope description:EFDEMEECS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7686182;

  5. Mapping of serotype-specific, immunodominant epitopes in the NS-4 region of hepatitis C virus (HCV): use of type-specific peptides to serologically di...

    ID: 1289328

    Description: epitope description:DEMEECSQH antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7686182;

  6. Mapping of serotype-specific, immunodominant epitopes in the NS-4 region of hepatitis C virus (HCV): use of type-specific peptides to serologically di...

    ID: 1289333

    Description: epitope description:ECSQHLPYI antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7686182;

  7. Mapping of protective and cross-reactive domains of the type A neurotoxin of Clostridium botulinum.

    ID: 1276448

    Description: epitope description:LNSSLYRGTKFIIKKYASGNKDNIVRNNDRVYINVVVKNKEYRLATNASQAGVEKILSALEIPDVGNLSQVVVMKSKNDQGITNKCKMNLQDNNGNDIGFIGFHQFNNIAKLVASNWYNRQIERSSRTLG...

    Publication: 9014296;

  8. Selective and efficient immunoprecipitation of the disease-associated form of the prion protein can be mediated by nonspecific interactions between mo...

    ID: 1276466

    Description: epitope description:HMAGAAAA antigen name:Major prion protein host organism:Mus musculus Biozzi antibody name:Pri-308

    Publication: 15140886;

  9. Selective and efficient immunoprecipitation of the disease-associated form of the prion protein can be mediated by nonspecific interactions between mo...

    ID: 1276467

    Description: epitope description:TQYERE antigen name:Major prion protein host organism:Mus musculus Biozzi antibody name:Pri-917

    Publication: 15140886;

  10. Selective and efficient immunoprecipitation of the disease-associated form of the prion protein can be mediated by nonspecific interactions between mo...

    ID: 1276468

    Description: epitope description:RYPNQVYYRPV antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:Bar-234

    Publication: 15140886;

  11. Selective and efficient immunoprecipitation of the disease-associated form of the prion protein can be mediated by nonspecific interactions between mo...

    ID: 1276471

    Description: epitope description:DYEDRYYREN antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:SAF-53, SAF-61

    Publication: 15140886;

  12. Peptide immunogen mimicry of putative E1 glycoprotein-specific epitopes in hepatitis C virus.

    ID: 1276617

    Description: epitope description:SSIVYEAADMIMHT antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 8207814;

  13. Peptides derived from the unique region of B19 parvovirus minor capsid protein elicit neutralizing antibodies in rabbits.

    ID: 1276621

    Description: epitope description:NISLDNPLENPSSLFDLVARIK antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7530397;

  14. Applicability of three anti-PrP peptide sera including staining of tonsils and brainstem of sheep with scrapie.

    ID: 1276645

    Description: epitope description:GSAMSRPLIHFGN antigen name:Major prion protein host organism:Oryctolagus cuniculus New Zealand White antibody name:R521

    Publication: 10871546;

  15. Applicability of three anti-PrP peptide sera including staining of tonsils and brainstem of sheep with scrapie.

    ID: 1276646

    Description: epitope description:GQGGSHSQWNKPSKPKTNMK antigen name:Major prion protein host organism:Oryctolagus cuniculus New Zealand White antibody name:R505

    Publication: 10871546;

  16. Applicability of three anti-PrP peptide sera including staining of tonsils and brainstem of sheep with scrapie.

    ID: 1276649

    Description: epitope description:WSDVGLCKKRPKP antigen name:Major prion protein host organism:Oryctolagus cuniculus New Zealand White antibody name:1B3

    Publication: 10871546;

  17. Peptides derived from the unique region of B19 parvovirus minor capsid protein elicit neutralizing antibodies in rabbits.

    ID: 1276670

    Description: epitope description:PGTNYVGPGNELQAGPPQSAVD antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7530397;

  18. Peptides derived from the unique region of B19 parvovirus minor capsid protein elicit neutralizing antibodies in rabbits.

    ID: 1276675

    Description: epitope description:PQSAVDSAARIHDFRYSQLAKL antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7530397;

  19. Peptides derived from the unique region of B19 parvovirus minor capsid protein elicit neutralizing antibodies in rabbits.

    ID: 1276681

    Description: epitope description:ADEELLKNIKNETGFQAQVVKD antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7530397;

  20. Peptides derived from the unique region of B19 parvovirus minor capsid protein elicit neutralizing antibodies in rabbits.

    ID: 1276687

    Description: epitope description:AQVVKDYFTLKGAAAPVAHFQG antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7530397;

  21. Peptides derived from the unique region of B19 parvovirus minor capsid protein elicit neutralizing antibodies in rabbits.

    ID: 1276696

    Description: epitope description:SEKYPSMTSVNSAEASTGAGGG antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7530397;

  22. Peptides derived from the unique region of B19 parvovirus minor capsid protein elicit neutralizing antibodies in rabbits.

    ID: 1276699

    Description: epitope description:TGAGGGGSNSVKSMWSEGATFS antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7530397;

  23. Peptides derived from the unique region of B19 parvovirus minor capsid protein elicit neutralizing antibodies in rabbits.

    ID: 1276700

    Description: epitope description:TGAGGGGSNSVKSMWSEGATFS antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 7530397;

  24. Conformational variation between allelic variants of cell-surface ovine prion protein.

    ID: 1276711

    Description: epitope description:PVDQY antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:683, 884

    Publication: 15070397;

  25. Identification of a cytoplasmic region of the Torpedo nicotinic acetylcholine receptor alpha-subunit by epitope mapping.

    ID: 1276716

    Description: epitope description:LSTFMESGEWVMK antigen name:Acetylcholine receptor subunit alpha host organism:Mus musculus antibody name:A14

    Publication: 1688436;

  26. Epitope mapping of the NS4 and NS5 gene products of hepatitis C virus and the use of a chimeric NS4-NS5 synthetic peptide for serodiagnosis.

    ID: 1276718

    Description: epitope description:FDPLVAEE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8537460;

  27. Epitope mapping of the NS4 and NS5 gene products of hepatitis C virus and the use of a chimeric NS4-NS5 synthetic peptide for serodiagnosis.

    ID: 1276720

    Description: epitope description:PLVAEEDE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8537460;

  28. Epitope mapping of the NS4 and NS5 gene products of hepatitis C virus and the use of a chimeric NS4-NS5 synthetic peptide for serodiagnosis.

    ID: 1276724

    Description: epitope description:EREVSVPA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8537460;

  29. Epitope mapping of the NS4 and NS5 gene products of hepatitis C virus and the use of a chimeric NS4-NS5 synthetic peptide for serodiagnosis.

    ID: 1276726

    Description: epitope description:VPAEILRK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8537460;

  30. Epitope mapping of the NS4 and NS5 gene products of hepatitis C virus and the use of a chimeric NS4-NS5 synthetic peptide for serodiagnosis.

    ID: 1276729

    Description: epitope description:ILRKSRRF antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8537460;

  31. Epitope mapping of the NS4 and NS5 gene products of hepatitis C virus and the use of a chimeric NS4-NS5 synthetic peptide for serodiagnosis.

    ID: 1276734

    Description: epitope description:PALPVWAR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8537460;

  32. Epitope mapping of the NS4 and NS5 gene products of hepatitis C virus and the use of a chimeric NS4-NS5 synthetic peptide for serodiagnosis.

    ID: 1276735

    Description: epitope description:ALPVWARP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8537460;

  33. Epitope mapping of the NS4 and NS5 gene products of hepatitis C virus and the use of a chimeric NS4-NS5 synthetic peptide for serodiagnosis.

    ID: 1276739

    Description: epitope description:WARPDYNP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8537460;

  34. Epitope mapping of the NS4 and NS5 gene products of hepatitis C virus and the use of a chimeric NS4-NS5 synthetic peptide for serodiagnosis.

    ID: 1276744

    Description: epitope description:YNPLLVET antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8537460;

  35. Epitope mapping of the NS4 and NS5 gene products of hepatitis C virus and the use of a chimeric NS4-NS5 synthetic peptide for serodiagnosis.

    ID: 1276750

    Description: epitope description:ETWKKPDY antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8537460;

  36. Epitope mapping of the NS4 and NS5 gene products of hepatitis C virus and the use of a chimeric NS4-NS5 synthetic peptide for serodiagnosis.

    ID: 1276753

    Description: epitope description:KKPDYEPP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8537460;

  37. Epitope mapping of the NS4 and NS5 gene products of hepatitis C virus and the use of a chimeric NS4-NS5 synthetic peptide for serodiagnosis.

    ID: 1276763

    Description: epitope description:AEILRKSR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8537460;

  38. Epitope mapping of the NS4 and NS5 gene products of hepatitis C virus and the use of a chimeric NS4-NS5 synthetic peptide for serodiagnosis.

    ID: 1276765

    Description: epitope description:KSRRFAPA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8537460;

  39. Epitope mapping of the NS4 and NS5 gene products of hepatitis C virus and the use of a chimeric NS4-NS5 synthetic peptide for serodiagnosis.

    ID: 1276769

    Description: epitope description:EPPVVHGC antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8537460;

  40. Epitope mapping of the NS4 and NS5 gene products of hepatitis C virus and the use of a chimeric NS4-NS5 synthetic peptide for serodiagnosis.

    ID: 1276773

    Description: epitope description:GLLQTASRHAEVITPAVQTN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8537460;

  41. Immunodominant antigenic regions in a structural protein of the hepatitis E virus.

    ID: 1276786

    Description: epitope description:QLFYSRPVVSANGEPTVKLY antigen name:Capsid protein host organism:Homo sapiens

    Publication: 8259678;

  42. Immunodominant antigenic regions in a structural protein of the hepatitis E virus.

    ID: 1276792

    Description: epitope description:DWTKVTLDGRPLSTIQ antigen name:Capsid protein host organism:Homo sapiens

    Publication: 8259678;

  43. Immunodominant antigenic regions in a structural protein of the hepatitis E virus.

    ID: 1276796

    Description: epitope description:ISSAGGQLFYSRPVVSANGE antigen name:Capsid protein host organism:Homo sapiens

    Publication: 8259678;

  44. Immunodominant antigenic regions in a structural protein of the hepatitis E virus.

    ID: 1276798

    Description: epitope description:QLFYSRPVVSANGEPTVKLY antigen name:Capsid protein host organism:Homo sapiens

    Publication: 8259678;

  45. Immunodominant antigenic regions in a structural protein of the hepatitis E virus.

    ID: 1276812

    Description: epitope description:SLTAAEYDQSTYGSSTGPVY antigen name:Capsid protein host organism:Homo sapiens

    Publication: 8259678;

  46. Immunodominant antigenic regions in a structural protein of the hepatitis E virus.

    ID: 1276816

    Description: epitope description:NAQQDKGIAIPHDIDLGESR antigen name:Capsid protein host organism:Homo sapiens

    Publication: 8259678;

  47. Immunodominant antigenic regions in a structural protein of the hepatitis E virus.

    ID: 1276828

    Description: epitope description:SPAPSRPFSVLRANDVLWLS antigen name:Capsid protein host organism:Homo sapiens

    Publication: 8259678;

  48. Peptide immunogen mimicry of putative E1 glycoprotein-specific epitopes in hepatitis C virus.

    ID: 1276829

    Description: epitope description:SSIVYEAADMIMHT antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 8207814;

  49. Identification and characterization of novel neutralizing epitopes in the receptor-binding domain of SARS-CoV spike protein: revealing the critical an...

    ID: 1276862

    Description: epitope description:D429, R441, E452, D454 antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:S6, S37, S50

    Publication: 16725238;

  50. Identification and characterization of novel neutralizing epitopes in the receptor-binding domain of SARS-CoV spike protein: revealing the critical an...

    ID: 1276871

    Description: epitope description:D429, R441, D454, D463 antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:MAb S53

    Publication: 16725238;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston