Characterization of pathogenic T cells and autoantibodies in C-protein-induced autoimmune polymyositis.

ID: 1708449

Description: epitope description:KCFTELFVKEPPVLIVTPLEDQQVFVGDRV antigen name:Myosin-binding protein C, fast-type host organism:Rattus norvegicus Lewis

Mapping the extracellular topography of the alpha-chain in free and in membrane-bound acetylcholine receptor by antibodies against overlapping peptide...

ID: 1708450

Description: epitope description:EVNQIVETNVRLRQQW antigen name:Acetylcholine receptor subunit alpha host organism:Mus musculus ICR

Mapping the extracellular topography of the alpha-chain in free and in membrane-bound acetylcholine receptor by antibodies against overlapping peptide...

ID: 1708452

Description: epitope description:EVNQIVETNVRLRQQW antigen name:Acetylcholine receptor subunit alpha host organism:Mus musculus ICR

Immunogenicity evaluation of a lipidic amino acid-based synthetic peptide vaccine for Chlamydia trachomatis.

ID: 1708467

Description: epitope description:TIFDVT antigen name:Major outer membrane porin, serovar D host organism:Mus musculus B10.A

Characterization of pathogenic T cells and autoantibodies in C-protein-induced autoimmune polymyositis.

ID: 1708478

Description: epitope description:VGDRVEMAVEVSEEGAQVMWMKDGVELTRE antigen name:Myosin-binding protein C, fast-type host organism:Rattus norvegicus Lewis

Characterization of pathogenic T cells and autoantibodies in C-protein-induced autoimmune polymyositis.

ID: 1708491

Description: epitope description:LIVEEKQLEVLQDIADLTVKASEQAVFKC antigen name:Myosin-binding protein C, fast-type host organism:Rattus norvegicus Lewis

Characterization of pathogenic T cells and autoantibodies in C-protein-induced autoimmune polymyositis.

ID: 1708499

Description: epitope description:DEGDYTFVPDGYALGSLSAKLNFLEIKVE antigen name:Myosin-binding protein C, fast-type host organism:Rattus norvegicus Lewis

Characterization of pathogenic T cells and autoantibodies in C-protein-induced autoimmune polymyositis.

ID: 1708503

Description: epitope description:EIKVEYVPKQEPPKIHLDCSGKTSENAIV antigen name:Myosin-binding protein C, fast-type host organism:Rattus norvegicus Lewis

Characterization of pathogenic T cells and autoantibodies in C-protein-induced autoimmune polymyositis.

ID: 1708505

Description: epitope description:ENAIVVVAGNKLRLDVSITGE antigen name:Myosin-binding protein C, fast-type host organism:Rattus norvegicus Lewis

Characterization of pathogenic T cells and autoantibodies in C-protein-induced autoimmune polymyositis.

ID: 1708506

Description: epitope description:ENAIVVVAGNKLRLDVSITGE antigen name:Myosin-binding protein C, fast-type host organism:Rattus norvegicus Lewis

Main immunogenic region of Torpedo electroplax and human muscle acetylcholine receptor: localization and microheterogeneity revealed by the use of syn...

ID: 1708512

Description: epitope description:SAIEGVKYIAEHMKSDEESSN antigen name:Acetylcholine receptor subunit alpha host organism:Rattus norvegicus Lewis antibody name:153, 1...

Immunogenicity evaluation of a lipidic amino acid-based synthetic peptide vaccine for Chlamydia trachomatis.

ID: 1708558

Description: epitope description:NPTIAG antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

Immunogenicity evaluation of a lipidic amino acid-based synthetic peptide vaccine for Chlamydia trachomatis.

ID: 1708567

Description: epitope description:AGLQND host organism:Mus musculus C57BL/10

Immunogenicity evaluation of a lipidic amino acid-based synthetic peptide vaccine for Chlamydia trachomatis.

ID: 1708576

Description: epitope description:IAQPKS antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

Immunogenicity evaluation of a lipidic amino acid-based synthetic peptide vaccine for Chlamydia trachomatis.

ID: 1708577

Description: epitope description:IAQPKS antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

Immunogenicity evaluation of a lipidic amino acid-based synthetic peptide vaccine for Chlamydia trachomatis.

ID: 1708582

Description: epitope description:PKSAET antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

Immunogenicity evaluation of a lipidic amino acid-based synthetic peptide vaccine for Chlamydia trachomatis.

ID: 1708583

Description: epitope description:KSAETI antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

Immunogenicity evaluation of a lipidic amino acid-based synthetic peptide vaccine for Chlamydia trachomatis.

ID: 1708586

Description: epitope description:ETIFDV antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

Immunogenicity evaluation of a lipidic amino acid-based synthetic peptide vaccine for Chlamydia trachomatis.

ID: 1708588

Description: epitope description:IFDVTT antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

Immunogenicity evaluation of a lipidic amino acid-based synthetic peptide vaccine for Chlamydia trachomatis.

ID: 1708596

Description: epitope description:PTIAGA antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

Immunogenicity evaluation of a lipidic amino acid-based synthetic peptide vaccine for Chlamydia trachomatis.

ID: 1708605

Description: epitope description:QNDPTT host organism:Mus musculus C57BL/10

Immunogenicity evaluation of a lipidic amino acid-based synthetic peptide vaccine for Chlamydia trachomatis.

ID: 1708610

Description: epitope description:TNVARP host organism:Mus musculus C57BL/10

Epitope discovery using bacteriophage display: the minimum epitope of an anti-IRBP antibody.

ID: 1708611

Description: epitope description:ERVTRLEWPKNDPRI host organism:Mus musculus antibody name:H3B5

Epitope discovery using bacteriophage display: the minimum epitope of an anti-IRBP antibody.

ID: 1708627

Description: epitope description:QVIKMDLPQYEPRLA host organism:Mus musculus antibody name:H3B5

Mapping of a functional autoimmune epitope on the beta 1-adrenergic receptor in patients with idiopathic dilated cardiomyopathy.

ID: 1708639

Description: epitope description:HWWRAESDEARRCYNDPKCCDFVTNR antigen name:Beta-1 adrenergic receptor host organism:Oryctolagus cuniculus

Immune responses to peptides derived from the retinal protein IRBP: immunopathogenic determinants are not necessarily immunodominant.

ID: 1708683

Description: epitope description:AALTRAQEMLQHT antigen name:Retinol-binding protein 3 host organism:Rattus norvegicus Lewis

Immune responses to peptides derived from the retinal protein IRBP: immunopathogenic determinants are not necessarily immunodominant.

ID: 1708689

Description: epitope description:PTARSVGAADGSSWEGVGVV antigen name:Retinol-binding protein 3 host organism:Rattus norvegicus Lewis

Autoreactive IgG elicited in mice by the non-dominant but pathogenic thyroglobulin peptide (2495-2511): implications for thyroid autoimmunity.

ID: 1708720

Description: epitope description:GLINRAKAVKQFEESQG antigen name:Thyroglobulin host organism:Mus musculus B10.BR

Epitopes in the linker subdomain region of envoplakin recognized by autoantibodies in paraneoplastic pemphigus patients.

ID: 1708857

Description: epitope description:LEPETGKDMSPYEAYKRGII antigen name:Envoplakin host organism:Homo sapiens

Vaccination with a synthetic zona pellucida peptide produces long-term contraception in female mice.

ID: 1708868

Description: epitope description:CSNSSSSQFQIHGPRQ antigen name:Zona pellucida sperm-binding protein 3 host organism:Mus musculus Swiss

Periodate-resistant carbohydrate epitopes recognized by IgG and IgE antibodies from some of the immunized mice and patients with allergy.

ID: 1708876

Description: epitope description:alpha-D-Man-(1->6)-[alpha-D-Man-(1->3)]-[beta-D-Xyl-(1->2)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-Glc...

Periodate-resistant carbohydrate epitopes recognized by IgG and IgE antibodies from some of the immunized mice and patients with allergy.

ID: 1708878

Description: epitope description:3-O-{(1R)-1-[(1,3-dihydroxypropan-2-yl)oxy]-2-hydroxyethyl}-2,6-bis-O-{(1S)-1-[(1,3-dihydroxypropan-2-yl)oxy]-2-hydroxyethyl}-beta...

Periodate-resistant carbohydrate epitopes recognized by IgG and IgE antibodies from some of the immunized mice and patients with allergy.

ID: 1708880

Description: epitope description:3-O-{(1R)-1-[(1,3-dihydroxypropan-2-yl)oxy]-2-hydroxyethyl}-2,6-bis-O-{(1S)-1-[(1,3-dihydroxypropan-2-yl)oxy]-2-hydroxyethyl}-beta...

The x-ray structure of an anti-tumour antibody in complex with antigen.

ID: 1708884

Description: epitope description:methyl 8-{[alpha-L-fucopyranosyl-(1->3)-[alpha-L-fucopyranosyl-(1->2)-beta-D-galactopyranosyl-(1->4)]-2-acetamido-2-deoxy-beta-D-g...

Epitopes in the linker subdomain region of envoplakin recognized by autoantibodies in paraneoplastic pemphigus patients.

ID: 1708890

Description: epitope description:DMSPYEAYKRGIIDRGQYLQ antigen name:Envoplakin host organism:Homo sapiens

Epitopes in the linker subdomain region of envoplakin recognized by autoantibodies in paraneoplastic pemphigus patients.

ID: 1708891

Description: epitope description:YKRGIIDRGQYLQLQELECD antigen name:Envoplakin host organism:Homo sapiens

Epitopes in the linker subdomain region of envoplakin recognized by autoantibodies in paraneoplastic pemphigus patients.

ID: 1708896

Description: epitope description:RGQYLQLQELECDWEEVTTS antigen name:Envoplakin host organism:Homo sapiens

Epitopes in the linker subdomain region of envoplakin recognized by autoantibodies in paraneoplastic pemphigus patients.

ID: 1708897

Description: epitope description:RGQYLQLQELECDWEEVTTS antigen name:Envoplakin host organism:Homo sapiens

Epitopes in the linker subdomain region of envoplakin recognized by autoantibodies in paraneoplastic pemphigus patients.

ID: 1708900

Description: epitope description:QELECDWEEVTTSGPCGEES antigen name:Envoplakin host organism:Homo sapiens

Epitopes in the linker subdomain region of envoplakin recognized by autoantibodies in paraneoplastic pemphigus patients.

ID: 1708901

Description: epitope description:QELECDWEEVTTSGPCGEES antigen name:Envoplakin host organism:Homo sapiens

Epitopes in the linker subdomain region of envoplakin recognized by autoantibodies in paraneoplastic pemphigus patients.

ID: 1708902

Description: epitope description:QELECDWEEVTTSGPCGEES antigen name:Envoplakin host organism:Homo sapiens

The tyrosine phosphorylation site of the acetylcholine receptor beta subunit is located in a highly immunogenic epitope implicated in channel function...

ID: 1708906

Description: epitope description:PSPDSKPT antigen name:Acetylcholine receptor subunit beta host organism:Rattus norvegicus Lewis antibody name:10

Minimal motif mapping of a known epitope on human zona pellucida protein-4 using a peptide biosynthesis strategy.

ID: 1708910

Description: epitope description:PETQPGPLTLELQIAKDK antigen name:Zona pellucida sperm-binding protein 4 host organism:Oryctolagus cuniculus New Zealand White

The tyrosine phosphorylation site of the acetylcholine receptor beta subunit is located in a highly immunogenic epitope implicated in channel function...

ID: 1708912

Description: epitope description:DSKPTIISRAN antigen name:Acetylcholine receptor subunit beta host organism:Rattus norvegicus LOU antibody name:117

The tyrosine phosphorylation site of the acetylcholine receptor beta subunit is located in a highly immunogenic epitope implicated in channel function...

ID: 1708913

Description: epitope description:IKYIAEQLES antigen name:Acetylcholine receptor subunit beta host organism:Rattus norvegicus LOU antibody name:125

Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

ID: 1708954

Description: epitope description:PPPGRRP antigen name:Epstein-Barr nuclear antigen 1 host organism:Oryctolagus cuniculus New Zealand White

Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

ID: 1708963

Description: epitope description:PPPGMRPGPPP antigen name:Small nuclear ribonucleoprotein-associated proteins B and B' host organism:Oryctolagus cuniculus New Zeal...

Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

ID: 1708964

Description: epitope description:TRPNHTIY antigen name:U1 small nuclear ribonucleoprotein A host organism:Oryctolagus cuniculus New Zealand White

Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

ID: 1708971

Description: epitope description:VQGPVPGM antigen name:U1 small nuclear ribonucleoprotein A host organism:Oryctolagus cuniculus New Zealand White

Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

ID: 1708972

Description: epitope description:MTQAPRIMH antigen name:U1 small nuclear ribonucleoprotein A host organism:Oryctolagus cuniculus New Zealand White

Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

ID: 1708979

Description: epitope description:KSSKMLQHID antigen name:Small nuclear ribonucleoprotein-associated proteins B and B' host organism:Oryctolagus cuniculus New Zeala...

Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

ID: 1708991

Description: epitope description:AFDKHMNLIL antigen name:Small nuclear ribonucleoprotein-associated proteins B and B' host organism:Oryctolagus cuniculus New Zeala...

Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

ID: 1709004

Description: epitope description:AEREEKRVLG antigen name:Small nuclear ribonucleoprotein-associated proteins B and B' host organism:Oryctolagus cuniculus New Zeala...

Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

ID: 1709006

Description: epitope description:EKRVLGLVLL antigen name:Small nuclear ribonucleoprotein-associated proteins B and B' host organism:Oryctolagus cuniculus New Zeala...

Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

ID: 1709008

Description: epitope description:LGLVLLRGEN antigen name:Small nuclear ribonucleoprotein-associated proteins B and B' host organism:Oryctolagus cuniculus New Zeala...

Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

ID: 1709016

Description: epitope description:PPPKDTGIAR antigen name:Small nuclear ribonucleoprotein-associated proteins B and B' host organism:Oryctolagus cuniculus New Zeala...

Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

ID: 1709021

Description: epitope description:VPLAGAAGGP antigen name:Small nuclear ribonucleoprotein-associated proteins B and B' host organism:Oryctolagus cuniculus New Zeala...

Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

ID: 1709024

Description: epitope description:AGGPGIGRAA antigen name:Small nuclear ribonucleoprotein-associated proteins B and B' host organism:Oryctolagus cuniculus New Zeala...

Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

ID: 1709029

Description: epitope description:GRGIPAGVPM antigen name:Small nuclear ribonucleoprotein-associated proteins B and B' host organism:Oryctolagus cuniculus New Zeala...

Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

ID: 1709032

Description: epitope description:GVPMPQAPAG antigen name:Small nuclear ribonucleoprotein-associated proteins B and B' host organism:Oryctolagus cuniculus New Zeala...

Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

ID: 1709037

Description: epitope description:LAGPVRGVGG antigen name:Small nuclear ribonucleoprotein-associated proteins B and B' host organism:Oryctolagus cuniculus New Zeala...

Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

ID: 1709048

Description: epitope description:AAAAATASIA antigen name:Small nuclear ribonucleoprotein-associated proteins B and B' host organism:Oryctolagus cuniculus New Zeala...

Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

ID: 1709051

Description: epitope description:ASIAGAPTQY antigen name:Small nuclear ribonucleoprotein-associated proteins B and B' host organism:Oryctolagus cuniculus New Zeala...

Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

ID: 1709053

Description: epitope description:GAPTQYPPGR antigen name:Small nuclear ribonucleoprotein-associated proteins B and B' host organism:Oryctolagus cuniculus New Zeala...

Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

ID: 1709057

Description: epitope description:GGPPPPMGRG antigen name:Small nuclear ribonucleoprotein-associated proteins B and B' host organism:Oryctolagus cuniculus New Zeala...

Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

ID: 1709067

Description: epitope description:PPPPGMRPP antigen name:Small nuclear ribonucleoprotein-associated proteins B and B' host organism:Oryctolagus cuniculus New Zealan...

Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

ID: 1709070

Description: epitope description:VPETRPNH antigen name:U1 small nuclear ribonucleoprotein A host organism:Oryctolagus cuniculus New Zealand White

Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

ID: 1709073

Description: epitope description:TRPNHTIY antigen name:U1 small nuclear ribonucleoprotein A host organism:Oryctolagus cuniculus New Zealand White

Lupus-like autoantibody development in rabbits and mice after immunization with EBNA-1 fragments.

ID: 1709077

Description: epitope description:HTIYINNL antigen name:U1 small nuclear ribonucleoprotein A host organism:Oryctolagus cuniculus New Zealand White

Induction of cross-reactive humoral immune response by immunization with mimotopes of the hypervariable region 1 of the hepatitis C virus.

ID: 1706750

Description: epitope description:NTHTVGAAASRSTAGLTSLFSIGRSQK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

Induction of cross-reactive humoral immune response by immunization with mimotopes of the hypervariable region 1 of the hepatitis C virus.

ID: 1706755

Description: epitope description:NTRVTGGVQSRTTGTFVGLFTPGPSQR antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

Induction of cross-reactive humoral immune response by immunization with mimotopes of the hypervariable region 1 of the hepatitis C virus.

ID: 1706762

Description: epitope description:NTHVSGGRVGHTTRSLTSFFTPGPQQK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

Induction of cross-reactive humoral immune response by immunization with mimotopes of the hypervariable region 1 of the hepatitis C virus.

ID: 1706770

Description: epitope description:STRITAQAEGRGASTLTSLFTSGASQK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

Induction of cross-reactive humoral immune response by immunization with mimotopes of the hypervariable region 1 of the hepatitis C virus.

ID: 1706773

Description: epitope description:STRITAQAEGRGASTLTSLFTSGASQK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

Induction of cross-reactive humoral immune response by immunization with mimotopes of the hypervariable region 1 of the hepatitis C virus.

ID: 1706774

Description: epitope description:STRITAQAEGRGASTLTSLFTSGASQK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

Induction of cross-reactive humoral immune response by immunization with mimotopes of the hypervariable region 1 of the hepatitis C virus.

ID: 1706776

Description: epitope description:STIVSGGTVARTTHSLASLFTQGASQK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

Induction of cross-reactive humoral immune response by immunization with mimotopes of the hypervariable region 1 of the hepatitis C virus.

ID: 1706778

Description: epitope description:STIVSGGTVARTTHSLASLFTQGASQK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

Induction of cross-reactive humoral immune response by immunization with mimotopes of the hypervariable region 1 of the hepatitis C virus.

ID: 1706779

Description: epitope description:STIVSGGTVARTTHSLASLFTQGASQK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

Induction of cross-reactive humoral immune response by immunization with mimotopes of the hypervariable region 1 of the hepatitis C virus.

ID: 1706783

Description: epitope description:ETRVTGGAAGHTAFGFASFLAPGAKQK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

Induction of cross-reactive humoral immune response by immunization with mimotopes of the hypervariable region 1 of the hepatitis C virus.

ID: 1706791

Description: epitope description:NTYVTGGSAGRAVAGFAGLLQPGAKQN antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

Induction of cross-reactive humoral immune response by immunization with mimotopes of the hypervariable region 1 of the hepatitis C virus.

ID: 1706792

Description: epitope description:NTYVTGGSAGRAVAGFAGLLQPGAKQN antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

Induction of cross-reactive humoral immune response by immunization with mimotopes of the hypervariable region 1 of the hepatitis C virus.

ID: 1706793

Description: epitope description:NTYVTGGSAGRAVAGFAGLLQPGAKQN antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

Induction of cross-reactive humoral immune response by immunization with mimotopes of the hypervariable region 1 of the hepatitis C virus.

ID: 1706797

Description: epitope description:ETHSVGGSAAHTTSRFTSLFSPGPQQN antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

Induction of cross-reactive humoral immune response by immunization with mimotopes of the hypervariable region 1 of the hepatitis C virus.

ID: 1706798

Description: epitope description:ETHSVGGSAAHTTSRFTSLFSPGPQQN antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

Induction of cross-reactive humoral immune response by immunization with mimotopes of the hypervariable region 1 of the hepatitis C virus.

ID: 1706811

Description: epitope description:QTRTVGGANARNTYGLTTLFTTGPKQN antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

Induction of cross-reactive humoral immune response by immunization with mimotopes of the hypervariable region 1 of the hepatitis C virus.

ID: 1706826

Description: epitope description:NTHVTGGVVARNAYRITTFLNPGPAQN antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

Induction of cross-reactive humoral immune response by immunization with mimotopes of the hypervariable region 1 of the hepatitis C virus.

ID: 1706832

Description: epitope description:HTYTTGGTASRHTQAFAGLFDIGPQQK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

Induction of cross-reactive humoral immune response by immunization with mimotopes of the hypervariable region 1 of the hepatitis C virus.

ID: 1706837

Description: epitope description:KTHVTGMVAGKNAHTLSSIFTSGPSQN antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

Induction of cross-reactive humoral immune response by immunization with mimotopes of the hypervariable region 1 of the hepatitis C virus.

ID: 1706841

Description: epitope description:KTHVTGMVAGKNAHTLSSIFTSGPSQN antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

Induction of cross-reactive humoral immune response by immunization with mimotopes of the hypervariable region 1 of the hepatitis C virus.

ID: 1706843

Description: epitope description:GTHVTGGKVAYTTQGFTSFFSRGPSQK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

Induction of cross-reactive humoral immune response by immunization with mimotopes of the hypervariable region 1 of the hepatitis C virus.

ID: 1706849

Description: epitope description:ETYTSGGNAGHTMTGIVRFFAPGPKQN antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

Induction of cross-reactive humoral immune response by immunization with mimotopes of the hypervariable region 1 of the hepatitis C virus.

ID: 1706855

Description: epitope description:STYSMGGAAAHNARGLTSLFSSGASQR antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

Induction of cross-reactive humoral immune response by immunization with mimotopes of the hypervariable region 1 of the hepatitis C virus.

ID: 1706858

Description: epitope description:STYSMGGAAAHNARGLTSLFSSGASQR antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

Induction of cross-reactive humoral immune response by immunization with mimotopes of the hypervariable region 1 of the hepatitis C virus.

ID: 1706861

Description: epitope description:ETHVTGGSAGRSVLGIASFLTRGPKQN antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

Induction of cross-reactive humoral immune response by immunization with mimotopes of the hypervariable region 1 of the hepatitis C virus.

ID: 1706864

Description: epitope description:ETHVTGGSAGRSVLGIASFLTRGPKQN antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

Induction of cross-reactive humoral immune response by immunization with mimotopes of the hypervariable region 1 of the hepatitis C virus.

ID: 1706877

Description: epitope description:ETHVTGGNAGRTTAGLVGLLTPGAKQN antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

Induction of cross-reactive humoral immune response by immunization with mimotopes of the hypervariable region 1 of the hepatitis C virus.

ID: 1706878

Description: epitope description:ETHVTGGSAGHTAAGIASFFAPGPKQN antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

Induction of cross-reactive humoral immune response by immunization with mimotopes of the hypervariable region 1 of the hepatitis C virus.

ID: 1706880

Description: epitope description:ETHVTGGSAGHTAAGIASFFAPGPKQN antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

Induction of cross-reactive humoral immune response by immunization with mimotopes of the hypervariable region 1 of the hepatitis C virus.

ID: 1706881

Description: epitope description:ETHVTGGSAGHTAAGIASFFAPGPKQN antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

Structure of the insulin receptor ectodomain reveals a folded-over conformation.

ID: 1706907

Description: epitope description:K501, S503, Y504, I505, R506, T507, S508, L513, R515, E517, N574, H575, L579 antigen name:Insulin receptor host organism:Mus muscu...