Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Mapping antigenic domains expressed by Chlamydia trachomatis major outer membrane protein genes.

    ID: 1485865

    Description: epitope description:SATTVFDVTTLNPTIAGAGDVKASAEGQLG antigen name:Major outer membrane porin, serovar D host organism:Mus musculus antibody name:L21-10

    Publication: 2453883;

  2. Development of human antibodies against linear antigenic and immunogenic regions of respiratory syncytial virus (RSV) nucleocapsid and phospho-protein...

    ID: 1485883

    Description: epitope description:EKLNNLLEGNDSDNDLSLEDF antigen name:Phosphoprotein host organism:Homo sapiens antibody name:Paired Human Sera

    Publication: 9785215;

  3. Synthetic immunogens constructed from T-cell and B-cell stimulating peptides (T:B chimeras): preferential stimulation of unique T- and B-cell specific...

    ID: 1485998

    Description: epitope description:CEYNVFHNKTFELPRA antigen name:Small hydrophobic protein (SH) host organism:Mus musculus SJL

    Publication: 1688404;

  4. Major linear antibody epitopes and capsid proteins differentially induce protective immunity against Theiler's virus-induced demyelinating disease.

    ID: 1486159

    Description: epitope description:PIYGKTISTPSDYM antigen name:Cardiovirus B protein host organism:Mus musculus SJL

    Publication: 9060673;

  5. Major linear antibody epitopes and capsid proteins differentially induce protective immunity against Theiler's virus-induced demyelinating disease.

    ID: 1486160

    Description: epitope description:PIYGKTISTPSDYM antigen name:Cardiovirus B protein host organism:Mus musculus SJL

    Publication: 9060673;

  6. Major linear antibody epitopes and capsid proteins differentially induce protective immunity against Theiler's virus-induced demyelinating disease.

    ID: 1486161

    Description: epitope description:NDDASVDFVAEPVK antigen name:Cardiovirus B protein host organism:Mus musculus SJL

    Publication: 9060673;

  7. Major linear antibody epitopes and capsid proteins differentially induce protective immunity against Theiler's virus-induced demyelinating disease.

    ID: 1486183

    Description: epitope description:RWAPTGAPADVTDQL antigen name:Cardiovirus B protein host organism:Mus musculus SJL

    Publication: 9060673;

  8. Identification of mimotopes of the Japanese encephalitis virus envelope protein using phage-displayed combinatorial peptide library.

    ID: 1486188

    Description: epitope description:TQHPENQPQQRV host organism:Mus musculus BALB/c antibody name:mAb 2H2

    Publication: 15741739;

  9. Identification of mimotopes of the Japanese encephalitis virus envelope protein using phage-displayed combinatorial peptide library.

    ID: 1486224

    Description: epitope description:INIDSNPLHHLL host organism:Mus musculus BALB/c antibody name:mAb 2H2

    Publication: 15741739;

  10. Epitope mapping of the gp53 envelope protein of bovine viral diarrhea virus.

    ID: 1486232

    Description: epitope description:R764, D838 antigen name:Genome polyprotein host organism:Mus musculus antibody name:WB214n

    Publication: 1381537;

  11. Epitope mapping of the gp53 envelope protein of bovine viral diarrhea virus.

    ID: 1486233

    Description: epitope description:R764, D838 antigen name:Genome polyprotein host organism:Mus musculus antibody name:WB214n

    Publication: 1381537;

  12. Epitope mapping of the gp53 envelope protein of bovine viral diarrhea virus.

    ID: 1486235

    Description: epitope description:R764, T827 antigen name:Genome polyprotein host organism:Mus musculus antibody name:WB214n

    Publication: 1381537;

  13. Epitope mapping of the gp53 envelope protein of bovine viral diarrhea virus.

    ID: 1486252

    Description: epitope description:R764 antigen name:Genome polyprotein host organism:Mus musculus antibody name:WB115c

    Publication: 1381537;

  14. Production and characteristics of strain common antibodies against a synthetic polypeptide corresponding to the C-terminal region of potato virus Y co...

    ID: 1486254

    Description: epitope description:HTTEDVSPSMHTLLGVKNM antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1474133;

  15. Immunization of rats with synthetic peptide constructs from the glucan-binding or catalytic region of mutans streptococcal glucosyltransferase protect...

    ID: 1486423

    Description: epitope description:TGAQTIKGQKLYFKANGQQVKG antigen name:KxYKxGKxW signal domain protein host organism:Rattus norvegicus CD Charles River

    Publication: 7622235;

  16. Immunization of rats with synthetic peptide constructs from the glucan-binding or catalytic region of mutans streptococcal glucosyltransferase protect...

    ID: 1486426

    Description: epitope description:DANFDSIRVDAVDNVDADLLQ antigen name:KxYKxGKxW signal domain protein host organism:Rattus norvegicus CD Charles River

    Publication: 7622235;

  17. Virus-specific CTL responses induced by an H-2K(d)-restricted, motif-negative 15-mer peptide from the fusion protein of respiratory syncytial virus.

    ID: 1486434

    Description: epitope description:ELQLLMQSTPPTNNR antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 11807236;

  18. Mapping of antigenic domains in poliovirus VP1 involved in structural rearrangements during virus morphogenesis and antigenic alterations of the virio...

    ID: 1486468

    Description: epitope description:S23 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1.30, 1.44

    Publication: 7522372;

  19. Mapping of antigenic domains in poliovirus VP1 involved in structural rearrangements during virus morphogenesis and antigenic alterations of the virio...

    ID: 1486492

    Description: epitope description:YGPGVDY antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1.29

    Publication: 7522372;

  20. Identification of a T-cell epitope adjacent to neutralization antigenic site 1 of poliovirus type 1.

    ID: 1486527

    Description: epitope description:CVTIMTVDNPASTTNKDKLFAVWKITYKDT antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 1702841;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston