Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

ID: 1486538

Description: epitope description:KNTTTTQTQPSK antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

ID: 1486542

Description: epitope description:TTQTQPSKPTTK antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

ID: 1486560

Description: epitope description:PPNKPNNDFHFE antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

ID: 1486566

Description: epitope description:NDFHFEVFNFVP antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

ID: 1486567

Description: epitope description:DFHFEVFNFVPC antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

ID: 1486568

Description: epitope description:FHFEVFNFVPCS antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

ID: 1486573

Description: epitope description:FEVFNFVPCSIC antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

ID: 1486583

Description: epitope description:NKKPGKKTTTKP antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

ID: 1486586

Description: epitope description:PGKKTTTKPTKK antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

ID: 1486591

Description: epitope description:TTKPTKKPTFKT antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

ID: 1486592

Description: epitope description:TKPTKKPTFKTT antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

Epitope mapping of monoclonal antibodies to Escherichia coli ribosomal protein S3.

ID: 1486593

Description: epitope description:AAVEQPEKPAAQPKKQQRKGRK antigen name:30S ribosomal protein S3 host organism:Mus musculus BALB/c antibody name:392F10G8, 382D8G1B4, ...

Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

ID: 1486610

Description: epitope description:DHKPQTTKPKEV antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

Influence of administration dose and route on the immunogenicity and protective efficacy of BBG2Na, a recombinant respiratory syncytial virus subunit ...

ID: 1486611

Description: epitope description:HKPQTTKPKEVP antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:Mouse sera

Antigenicity modulation upon peptide cyclization: application to the GH loop of foot-and-mouth disease virus strain C1-Barcelona.

ID: 1486631

Description: epitope description:YTASARGDLAHLTTT antigen name:Polyprotein host organism:Mus musculus antibody name:SD6

Antigenicity modulation upon peptide cyclization: application to the GH loop of foot-and-mouth disease virus strain C1-Barcelona.

ID: 1486639

Description: epitope description:YTTSTRGDLAHVTAT antigen name:Polyprotein host organism:Mus musculus antibody name:SD6

Cross-reactive and group-specific immune responses to a neutralizing epitope of the human respiratory syncytial virus fusion protein.

ID: 1486648

Description: epitope description:PIVNKQSCSISNIETVIEFQQ antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/c

Cross-reactive and group-specific immune responses to a neutralizing epitope of the human respiratory syncytial virus fusion protein.

ID: 1486649

Description: epitope description:PIVNKQSCSISNIETVIEFQQ antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/c

Cross-reactive and group-specific immune responses to a neutralizing epitope of the human respiratory syncytial virus fusion protein.

ID: 1486653

Description: epitope description:PIVNKQSCSISNIETVIEFQQ antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus

Epitope analysis of an immunodominant domain on the P1 protein of Haemophilus influenzae type b using synthetic peptides and anti-idiotypic antibodies...

ID: 1486676

Description: epitope description:FKEVKTIGDKRTLTLNTTANYTSQAHANLYGLNLNYSF antigen name:Outer membrane protein P1 host organism:Mus musculus antibody name:P1.1, P1.6,...