Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. A chemically synthesized peptide which elicits humoral and cellular immune responses to mycobacterial antigens.

    ID: 1409671

    Description: epitope description:AKVNIKPLEDKIL antigen name:10 kDa chaperonin host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-H37Rv

    Publication: 3744551;

  2. A chemically synthesized peptide which elicits humoral and cellular immune responses to mycobacterial antigens.

    ID: 1409674

    Description: epitope description:AKVNIKPLEDKIL antigen name:10 kDa chaperonin host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-M. fortuitum

    Publication: 3744551;

  3. Immunization with a peptide corresponding to chlamydial heat shock protein 60 increases the humoral immune response in C3H mice to a peptide represent...

    ID: 1409695

    Description: epitope description:SATAIFDTTTLNPTIAGAGDVKASAEGQLG antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/6

    Publication: 10225836;

  4. How reliable is the structural prediction of IgE-binding epitopes of allergens? The case study of plant lipid transfer proteins.

    ID: 1409704

    Description: epitope description:RTTPDRQAA antigen name:Non-specific lipid-transfer protein host organism:Oryctolagus cuniculus

    Publication: 17059861;

  5. How reliable is the structural prediction of IgE-binding epitopes of allergens? The case study of plant lipid transfer proteins.

    ID: 1409706

    Description: epitope description:RTTPDRQAA antigen name:Non-specific lipid-transfer protein host organism:Oryctolagus cuniculus

    Publication: 17059861;

  6. Correlation between conformation and antibody binding: NMR structure of cross-reactive peptides from T. cruzi, human and L. braziliensis.

    ID: 1409748

    Description: epitope description:EEEDDDMGFGLFD antigen name:Other Trypanosoma cruzi protein host organism:Mus musculus antibody name:mAb

    Publication: 14988012;

  7. A monoclonal antibody against a carbohydrate epitope in lipopolysaccharide differentiates Chlamydophila psittaci from Chlamydophila pecorum, Chlamydop...

    ID: 1409757

    Description: epitope description:3-deoxy-alpha-D-manno-oct-2-ulopyranosonic acid antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:S6...

    Publication: 16282606;

  8. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409198

    Description: epitope description:STTTSTG antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  9. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409203

    Description: epitope description:TGPCKTC antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  10. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409206

    Description: epitope description:CKTCTTP antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston