Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Mapping of linear epitopes on the capsid proteins of swine vesicular disease virus using monoclonal antibodies.

    ID: 1486732

    Description: epitope description:AHETSLNAAGNSVIHYTNIN antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1D2

    Publication: 12029154;

  2. Mapping of linear epitopes on the capsid proteins of swine vesicular disease virus using monoclonal antibodies.

    ID: 1486781

    Description: epitope description:NRQDFTQDPG antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:4F9, 4H1, 5G3

    Publication: 12029154;

  3. Mapping of linear epitopes on the capsid proteins of swine vesicular disease virus using monoclonal antibodies.

    ID: 1486785

    Description: epitope description:KFTEPVKDIM antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1E10, 2A11, 5A9

    Publication: 12029154;

  4. Mapping of linear epitopes on the capsid proteins of swine vesicular disease virus using monoclonal antibodies.

    ID: 1486787

    Description: epitope description:KFTEPVKDIM antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1E10, 2A11, 5A9

    Publication: 12029154;

  5. Localization of epitopes in the toxins of Tityus serrulatus scorpions and neutralizing potential of therapeutic antivenoms.

    ID: 1486805

    Description: epitope description:KEGYAMDHEGCKFSC antigen name:Alpha-mammal toxin Ts2 host organism:Equus caballus

    Publication: 15970301;

  6. Localization of epitopes in the toxins of Tityus serrulatus scorpions and neutralizing potential of therapeutic antivenoms.

    ID: 1486814

    Description: epitope description:IRPSGYCGRECGIKK antigen name:Beta-mammal/insect toxin Ts1 host organism:Equus caballus

    Publication: 15970301;

  7. Localization of epitopes in the toxins of Tityus serrulatus scorpions and neutralizing potential of therapeutic antivenoms.

    ID: 1486816

    Description: epitope description:LPNWVKVWDRATNKC antigen name:Beta-mammal/insect toxin Ts1 host organism:Equus caballus

    Publication: 15970301;

  8. Localization of epitopes in the toxins of Tityus serrulatus scorpions and neutralizing potential of therapeutic antivenoms.

    ID: 1486820

    Description: epitope description:WNYDNAYCDKLCKDK antigen name:Toxin-5 host organism:Equus caballus

    Publication: 15970301;

  9. Identification of group-common linear epitopes in structural and nonstructural proteins of enteroviruses by using synthetic peptides.

    ID: 1483618

    Description: epitope description:PSDTMQTRHVKNYHSRSES antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7681848;

  10. Identification of exposed epitopes on the envelope glycoproteins of human T-cell lymphotropic virus type I (HTLV-I)

    ID: 1483838

    Description: epitope description:SSPCHNSLILPPFSLSPVPTLGSRS antigen name:Envelope glycoprotein gp62 host organism:Mus musculus BALB/c antibody name:4D4

    Publication: 9495252;

  11. Identification of exposed epitopes on the envelope glycoproteins of human T-cell lymphotropic virus type I (HTLV-I)

    ID: 1483841

    Description: epitope description:TKKPNRNGGGYYSASYSDPCSL antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9495252;

  12. Identification of exposed epitopes on the envelope glycoproteins of human T-cell lymphotropic virus type I (HTLV-I)

    ID: 1483842

    Description: epitope description:LNTEPSQLPPTAPPLLPHSNLDHI antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9495252;

  13. Intrathecal humoral immune response in HAM/TSP in relation to HLA haplotype analysis.

    ID: 1483873

    Description: epitope description:TKKPNRNGGGYYSASYSDPGSLKCPYL antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens antibody name:Intrathecal

    Publication: 8937542;

  14. Minor displacements in the insertion site provoke major differences in the induction of antibody responses by chimeric parvovirus-like particles.

    ID: 1483886

    Description: epitope description:NPASTTNKDK antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 10544085;

  15. Anti-PorA antibodies elicited by immunization with peptides conjugated to P64k.

    ID: 1483899

    Description: epitope description:PIQNSKSAYTPAHYTRQNNADVFVPAVVGKPGS antigen name:Major outer membrane protein P.IA host organism:Mus musculus

    Publication: 11027638;

  16. Anti-PorA antibodies elicited by immunization with peptides conjugated to P64k.

    ID: 1483901

    Description: epitope description:PIQNSKSAYTPAHYTRQNNADVFVPAVVGKPGS antigen name:Major outer membrane protein P.IA host organism:Mus musculus BALB/c

    Publication: 11027638;

  17. Bispecific abs against modified protein and DNA with oxidized lipids.

    ID: 1483916

    Description: epitope description:(2E,4S)-4-hydroxynon-2-enal host organism:Mus musculus antibody name:S412

    Publication: 16603628;

  18. Bispecific abs against modified protein and DNA with oxidized lipids.

    ID: 1483927

    Description: epitope description:(2E,4R)-4-hydroxynon-2-enal host organism:Mus musculus antibody name:R310

    Publication: 16603628;

  19. Native-like cyclic peptide models of a viral antigenic site: finding a balance between rigidity and flexibility.

    ID: 1483975

    Description: epitope description:YTASARGDLAHLTTTHARHLP antigen name:Polyprotein host organism:Mus musculus BALB/c antibody name:SD6

    Publication: 10679891;

  20. Native-like cyclic peptide models of a viral antigenic site: finding a balance between rigidity and flexibility.

    ID: 1483981

    Description: epitope description:TTCTASARGDLAHLTTTHACHL + CYSTL(C3, C20) host organism:Mus musculus BALB/c antibody name:SD6

    Publication: 10679891;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston