Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

ID: 1761197

Description: epitope description:GPDRSPRQPPVLPAA antigen name:Putative HTLV-1-related endogenous sequence host organism:Homo sapiens

Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

ID: 1761198

Description: epitope description:PRQPPVLPAAAAQPD antigen name:Putative HTLV-1-related endogenous sequence host organism:Homo sapiens

Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

ID: 1761199

Description: epitope description:VLPAAAAQPDSSSAQ antigen name:Putative HTLV-1-related endogenous sequence host organism:Homo sapiens

Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

ID: 1761205

Description: epitope description:KRRWATRGPAHPAFA antigen name:Putative HTLV-1-related endogenous sequence host organism:Homo sapiens

Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

ID: 1761213

Description: epitope description:LWRCALRWAERQVGA antigen name:Putative HTLV-1-related endogenous sequence host organism:Homo sapiens

Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

ID: 1761214

Description: epitope description:LRWAERQVGALGAES antigen name:Putative HTLV-1-related endogenous sequence host organism:Homo sapiens

Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

ID: 1761220

Description: epitope description:PRSRHPGGPGTPQIR antigen name:ORF2 host organism:Homo sapiens

Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

ID: 1761222

Description: epitope description:RVPRIPRDPRPPRPP antigen name:Probable RNA-binding protein host organism:Homo sapiens

Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

ID: 1761224

Description: epitope description:PSRRRRRRKATLAPA antigen name:Core-capsid bridging protein host organism:Homo sapiens

Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

ID: 1761225

Description: epitope description:WWARRRRRWRRWKRR antigen name:Other Torque teno virus protein host organism:Homo sapiens

Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

ID: 1761226

Description: epitope description:SVEVRKRRWVTFCSA antigen name:Gag polyprotein host organism:Homo sapiens

Epitopes of calreticulin recognised by IgA autoantibodies from patients with hepatic and coeliac disease.

ID: 1761232

Description: epitope description:GKFVLSSGKF antigen name:Calreticulin host organism:Homo sapiens

Epitopes of calreticulin recognised by IgA autoantibodies from patients with hepatic and coeliac disease.

ID: 1761235

Description: epitope description:EYNIMFGPDI antigen name:Calreticulin host organism:Homo sapiens

Epitopes of calreticulin recognised by IgA autoantibodies from patients with hepatic and coeliac disease.

ID: 1761247

Description: epitope description:KGKNVLINKD antigen name:Calreticulin host organism:Homo sapiens

Epitopes of calreticulin recognised by IgA autoantibodies from patients with hepatic and coeliac disease.

ID: 1761251

Description: epitope description:QVKSGTIFDN antigen name:Calreticulin host organism:Homo sapiens

Epitopes of calreticulin recognised by IgA autoantibodies from patients with hepatic and coeliac disease.

ID: 1761253

Description: epitope description:GTIFDNFLIT antigen name:Calreticulin host organism:Homo sapiens

Epitopes of calreticulin recognised by IgA autoantibodies from patients with hepatic and coeliac disease.

ID: 1761261

Description: epitope description:KSGTIFDNFL antigen name:Calreticulin host organism:Homo sapiens

Epitopes of calreticulin recognised by IgA autoantibodies from patients with hepatic and coeliac disease.

ID: 1761266

Description: epitope description:QVKSGTIFDN antigen name:Calreticulin host organism:Homo sapiens

Epitopes of calreticulin recognised by IgA autoantibodies from patients with hepatic and coeliac disease.

ID: 1761267

Description: epitope description:KSGTIFDNFL antigen name:Calreticulin host organism:Homo sapiens

Epitopes of calreticulin recognised by IgA autoantibodies from patients with hepatic and coeliac disease.

ID: 1761268

Description: epitope description:IFDNFLITND antigen name:Calreticulin host organism:Homo sapiens

Epitopes of calreticulin recognised by IgA autoantibodies from patients with hepatic and coeliac disease.

ID: 1761271

Description: epitope description:RLKEEEEDKK antigen name:Calreticulin host organism:Homo sapiens

Epitopes of calreticulin recognised by IgA autoantibodies from patients with hepatic and coeliac disease.

ID: 1761275

Description: epitope description:DEEKDKGLQTSQ antigen name:Calreticulin host organism:Homo sapiens

Pathogenic epitopes of autoantibodies in pemphigus reside in the amino-terminal adhesive region of desmogleins which are unmasked by proteolytic proce...

ID: 1761278

Description: epitope description:ERPLELRVRVLDI antigen name:Desmoglein-1 host organism:Homo sapiens antibody name:3–30/3h

Production of thyroid-stimulating antibodies in mice by immunization with T-cell epitopes of human thyrotropin receptor.

ID: 1761383

Description: epitope description:TKVYSTDIFFILEITDNPY antigen name:Thyrotropin receptor host organism:Mus musculus DBA/1

Reversible contraception in female baboons immunized with a synthetic epitope of sperm-specific lactate dehydrogenase.

ID: 1761490

Description: epitope description:EKLIEDDENSQC antigen name:L-lactate dehydrogenase C chain host organism:Papio cynocephalus

Comparative effectiveness of the cholera toxin B subunit and alkaline phosphatase as carriers for oral vaccines.

ID: 1761491

Description: epitope description:SAWNSDSEKPFDDHL antigen name:UniProt:I6TY13 host organism:Mus musculus C57BL/6

A contraceptive peptide vaccine targeting sulfated glycoprotein ZP2 of the mouse zona pellucida.

ID: 1761506

Description: epitope description:RGTVLYKNEVGE host organism:Rattus antibody name:IE-3

Production of monoclonal mouse IgE antibodies with DNP specificity by hybrid cell lines.

ID: 1761509

Description: epitope description:2,4-dinitrophenyl group host organism:Mus musculus BALB/c

A contraceptive peptide vaccine targeting sulfated glycoprotein ZP2 of the mouse zona pellucida.

ID: 1761510

Description: epitope description:TDVRYKD antigen name:Zona pellucida sperm-binding protein 2 host organism:Mus musculus (C57BL/6 X A/J)

Localization of an immunodominant domain on baculovirus-produced parvovirus B19 capsids: correlation to a major surface region on the native virus par...

ID: 1761514

Description: epitope description:TTYGNA antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody name:PAR1

Identification of antigenic epitopes of 1D antigen recognized by antibodies in the serum of patients with thyroid-associated ophthalmopathy.

ID: 1761532

Description: epitope description:ATKKEEEKKGGDRNTGLSRDKDKKREEMKEVAKKEDDEKVKGERRNTDTR antigen name:Leiomodin-1 host organism:Homo sapiens

Identification of antigenic epitopes of 1D antigen recognized by antibodies in the serum of patients with thyroid-associated ophthalmopathy.

ID: 1761534

Description: epitope description:LLKENTSLLKLGYHFELAGPRMTVTNLLSRNMDKQRQKR antigen name:Leiomodin-1 host organism:Homo sapiens

Identification of antigenic epitopes of 1D antigen recognized by antibodies in the serum of patients with thyroid-associated ophthalmopathy.

ID: 1761535

Description: epitope description:LLKENTSLLKLGYHFELAGPRMTVTNLLSRNMDKQRQKR antigen name:Leiomodin-1 host organism:Homo sapiens

Rabbit anti-HMG-17 antibodies recognize similar epitopes on the HMG-17 molecule as lupus autoantibodies. Relation with histone H1 defined epitopes.

ID: 1761543

Description: epitope description:PKRKAEGDAKGDKAK antigen name:Non-histone chromosomal protein HMG-17 host organism:Oryctolagus cuniculus

Rabbit anti-HMG-17 antibodies recognize similar epitopes on the HMG-17 molecule as lupus autoantibodies. Relation with histone H1 defined epitopes.

ID: 1761544

Description: epitope description:PKRKAEGDAKGDKAK antigen name:Non-histone chromosomal protein HMG-17 host organism:Homo sapiens

Platinum group metal sensitivity: reactivity to platinum group metal salts in platinum halide salt-sensitive workers.

ID: 1761548

Description: epitope description:ammonium hexachloroplatinate host organism:Homo sapiens

Rabbit anti-HMG-17 antibodies recognize similar epitopes on the HMG-17 molecule as lupus autoantibodies. Relation with histone H1 defined epitopes.

ID: 1761555

Description: epitope description:AKGDKAKVKDEPQRR antigen name:Non-histone chromosomal protein HMG-17 host organism:Homo sapiens

Rabbit anti-HMG-17 antibodies recognize similar epitopes on the HMG-17 molecule as lupus autoantibodies. Relation with histone H1 defined epitopes.

ID: 1761558

Description: epitope description:KAKVKDEPQRRSARL antigen name:Non-histone chromosomal protein HMG-17 host organism:Homo sapiens

Rabbit anti-HMG-17 antibodies recognize similar epitopes on the HMG-17 molecule as lupus autoantibodies. Relation with histone H1 defined epitopes.

ID: 1761562

Description: epitope description:QRRSARLSAKPAPPK antigen name:Non-histone chromosomal protein HMG-17 host organism:Oryctolagus cuniculus

Rabbit anti-HMG-17 antibodies recognize similar epitopes on the HMG-17 molecule as lupus autoantibodies. Relation with histone H1 defined epitopes.

ID: 1761576

Description: epitope description:EPKPKKAPAKKGEKV antigen name:Non-histone chromosomal protein HMG-17 host organism:Homo sapiens

Rabbit anti-HMG-17 antibodies recognize similar epitopes on the HMG-17 molecule as lupus autoantibodies. Relation with histone H1 defined epitopes.

ID: 1761577

Description: epitope description:KKAPAKKGEKVPKGK antigen name:Non-histone chromosomal protein HMG-17 host organism:Oryctolagus cuniculus

Rabbit anti-HMG-17 antibodies recognize similar epitopes on the HMG-17 molecule as lupus autoantibodies. Relation with histone H1 defined epitopes.

ID: 1761578

Description: epitope description:KKAPAKKGEKVPKGK antigen name:Non-histone chromosomal protein HMG-17 host organism:Homo sapiens

Rabbit anti-HMG-17 antibodies recognize similar epitopes on the HMG-17 molecule as lupus autoantibodies. Relation with histone H1 defined epitopes.

ID: 1761579

Description: epitope description:KKAPAKKGEKVPKGK antigen name:Non-histone chromosomal protein HMG-17 host organism:Homo sapiens

Rabbit anti-HMG-17 antibodies recognize similar epitopes on the HMG-17 molecule as lupus autoantibodies. Relation with histone H1 defined epitopes.

ID: 1761585

Description: epitope description:EKVPKGKKGKADAGK antigen name:Non-histone chromosomal protein HMG-17 host organism:Homo sapiens

Rabbit anti-HMG-17 antibodies recognize similar epitopes on the HMG-17 molecule as lupus autoantibodies. Relation with histone H1 defined epitopes.

ID: 1761589

Description: epitope description:GKADAGKDGNNPAEN antigen name:Non-histone chromosomal protein HMG-17 host organism:Oryctolagus cuniculus

Rabbit anti-HMG-17 antibodies recognize similar epitopes on the HMG-17 molecule as lupus autoantibodies. Relation with histone H1 defined epitopes.

ID: 1761598

Description: epitope description:AENGDAKTDQAQKAE antigen name:Non-histone chromosomal protein HMG-17 host organism:Oryctolagus cuniculus

Rabbit anti-HMG-17 antibodies recognize similar epitopes on the HMG-17 molecule as lupus autoantibodies. Relation with histone H1 defined epitopes.

ID: 1761607

Description: epitope description:AGAAKKPKKATGAAT antigen name:Histone H1.4 host organism:Homo sapiens

Rabbit anti-HMG-17 antibodies recognize similar epitopes on the HMG-17 molecule as lupus autoantibodies. Relation with histone H1 defined epitopes.

ID: 1761617

Description: epitope description:KPKAAKPKKAAAKKK antigen name:Histone H1.4 host organism:Homo sapiens

Rabbit anti-HMG-17 antibodies recognize similar epitopes on the HMG-17 molecule as lupus autoantibodies. Relation with histone H1 defined epitopes.

ID: 1761629

Description: epitope description:PPAKVEAKPKKAAAK antigen name:Non-histone chromosomal protein HMG-14 host organism:Homo sapiens

Rabbit anti-HMG-17 antibodies recognize similar epitopes on the HMG-17 molecule as lupus autoantibodies. Relation with histone H1 defined epitopes.

ID: 1761630

Description: epitope description:PPAKVEAKPKKAAAK antigen name:Non-histone chromosomal protein HMG-14 host organism:Homo sapiens

Localization of an immunodominant domain on baculovirus-produced parvovirus B19 capsids: correlation to a major surface region on the native virus par...

ID: 1761633

Description: epitope description:TTYGNA antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody name:PAR1

Immune responses of cynomolgus monkeys to phthalic anhydride.

ID: 1761634

Description: epitope description:phthalic anhydride host organism:Macaca fascicularis

Immunogenicity of amodiaquine in the rat.

ID: 1761637

Description: epitope description:amodiaquine host organism:Rattus norvegicus Wistar

Immunogenicity of amodiaquine in the rat.

ID: 1761640

Description: epitope description:amodiaquine host organism:Rattus norvegicus Wistar

Glycosylated ectodomain of the human thyrotropin receptor induces antibodies capable of reacting with multiple blocking antibody epitopes.

ID: 1761666

Description: epitope description:FRVTCKDIQRIPSLPPSTQT antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

Glycosylated ectodomain of the human thyrotropin receptor induces antibodies capable of reacting with multiple blocking antibody epitopes.

ID: 1761670

Description: epitope description:FYNLSKVTHIEIRNTRNLTY antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

Glycosylated ectodomain of the human thyrotropin receptor induces antibodies capable of reacting with multiple blocking antibody epitopes.

ID: 1761674

Description: epitope description:EITDNPYMTSIPVNAFQGLC antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

Glycosylated ectodomain of the human thyrotropin receptor induces antibodies capable of reacting with multiple blocking antibody epitopes.

ID: 1761683

Description: epitope description:DVSQTSVTALPSKGLEHLKE antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

Glycosylated ectodomain of the human thyrotropin receptor induces antibodies capable of reacting with multiple blocking antibody epitopes.

ID: 1761688

Description: epitope description:QSLRQRKSVNALNSPLHQEY antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

Glycosylated ectodomain of the human thyrotropin receptor induces antibodies capable of reacting with multiple blocking antibody epitopes.

ID: 1761696

Description: epitope description:MGCSSPPCECHQEEDFRVTC antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

Glycosylated ectodomain of the human thyrotropin receptor induces antibodies capable of reacting with multiple blocking antibody epitopes.

ID: 1761701

Description: epitope description:LDAVYLNKNKYLTVIDKDAF antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

Glycosylated ectodomain of the human thyrotropin receptor induces antibodies capable of reacting with multiple blocking antibody epitopes.

ID: 1761706

Description: epitope description:LHQEYEENLGDSIVGYKEKS antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

Immunoadsorption against two distinct epitopes on human type XVII collagen abolishes dermal-epidermal separation induced in vitro by autoantibodies fr...

ID: 1761715

Description: epitope description:RSILPYGDSMDRIE antigen name:Collagen alpha-1(XVII) chain host organism:Homo sapiens

Molecular characterization of a monoclonal antibody produced in response to a group C meningococcal polysaccharide peptide mimic.

ID: 1761721

Description: epitope description:ARIYYRYDGFAY antigen name:Immunoglobulin host organism:Mus musculus BALB/c antibody name:1A5, 1B6, 1C2, 2C4, 2C6, 3A3

Thyrotropin receptor knockout mice: studies on immunological tolerance to a major thyroid autoantigen.

ID: 1761723

Description: epitope description:MGCSSPPCECHQEEDFRVTC antigen name:Thyrotropin receptor host organism:Mus musculus C57BL/6 TSHR null

Thyrotropin receptor knockout mice: studies on immunological tolerance to a major thyroid autoantigen.

ID: 1761727

Description: epitope description:MGCSSPPCECHQEEDFRVTC antigen name:Thyrotropin receptor host organism:Mus musculus C57BL/6 TSHR null

Thyrotropin receptor knockout mice: studies on immunological tolerance to a major thyroid autoantigen.

ID: 1761732

Description: epitope description:PSTQTLKLIETHLRTIPSHA antigen name:Thyrotropin receptor host organism:Mus musculus C57BL/6 TSHR null

Thyrotropin receptor knockout mice: studies on immunological tolerance to a major thyroid autoantigen.

ID: 1761736

Description: epitope description:IPSHAFSNLPNISRIYVSID antigen name:Thyrotropin receptor host organism:Mus musculus C57BL/6 TSHR null

Thyrotropin receptor knockout mice: studies on immunological tolerance to a major thyroid autoantigen.

ID: 1761744

Description: epitope description:FYNLSKVTHIEIRNTRNLTY antigen name:Thyrotropin receptor host organism:Mus musculus C57BL/6 TSHR null

Thyrotropin receptor knockout mice: studies on immunological tolerance to a major thyroid autoantigen.

ID: 1761745

Description: epitope description:FYNLSKVTHIEIRNTRNLTY antigen name:Thyrotropin receptor host organism:Mus musculus C57BL/6 TSHR null

Thyrotropin receptor knockout mice: studies on immunological tolerance to a major thyroid autoantigen.

ID: 1761749

Description: epitope description:RNLTYIDPDALKELPLLKFL antigen name:Thyrotropin receptor host organism:Mus musculus C57BL/6 TSHR null

Thyrotropin receptor knockout mice: studies on immunological tolerance to a major thyroid autoantigen.

ID: 1761760

Description: epitope description:EITDNPYMTSIPVNAFQGLC antigen name:Thyrotropin receptor host organism:Mus musculus C57BL/6

Thyrotropin receptor knockout mice: studies on immunological tolerance to a major thyroid autoantigen.

ID: 1761772

Description: epitope description:LDAVYLNKNKYLTVIDKDAF antigen name:Thyrotropin receptor host organism:Mus musculus C57BL/6 TSHR null

Thyrotropin receptor knockout mice: studies on immunological tolerance to a major thyroid autoantigen.

ID: 1761773

Description: epitope description:LDAVYLNKNKYLTVIDKDAF antigen name:Thyrotropin receptor host organism:Mus musculus C57BL/6 TSHR null

Thyrotropin receptor knockout mice: studies on immunological tolerance to a major thyroid autoantigen.

ID: 1761793

Description: epitope description:LSYPSHCCAFKNQKKIRGIL antigen name:Thyrotropin receptor host organism:Mus musculus C57BL/6 TSHR null

Thyrotropin receptor knockout mice: studies on immunological tolerance to a major thyroid autoantigen.

ID: 1761797

Description: epitope description:IRGILESLMCNESSMQSLRQ antigen name:Thyrotropin receptor host organism:Mus musculus C57BL/6 TSHR null

Thyrotropin receptor knockout mice: studies on immunological tolerance to a major thyroid autoantigen.

ID: 1761800

Description: epitope description:QSLRQRKSVNALNSPLHQEY antigen name:Thyrotropin receptor host organism:Mus musculus C57BL/6 TSHR null

Identification and evaluation of an infertility-associated ZP3 epitope from the marsupial brushtail possum (Trichosurus vulpecula).

ID: 1761938

Description: epitope description:QAAELTLGPSAC antigen name:Zona pellucida 3 protein host organism:Trichosurus vulpecula

Identification and evaluation of an infertility-associated ZP3 epitope from the marsupial brushtail possum (Trichosurus vulpecula).

ID: 1761944

Description: epitope description:PDSLIYSTVLHY antigen name:Zona pellucida 3 protein host organism:Trichosurus vulpecula

Identification and evaluation of an infertility-associated ZP3 epitope from the marsupial brushtail possum (Trichosurus vulpecula).

ID: 1761948

Description: epitope description:DSSSIFISPRPG antigen name:Zona pellucida 3 protein host organism:Trichosurus vulpecula

Identification and evaluation of an infertility-associated ZP3 epitope from the marsupial brushtail possum (Trichosurus vulpecula).

ID: 1761949

Description: epitope description:FISPRPGQNVLR antigen name:Zona pellucida 3 protein host organism:Trichosurus vulpecula

Identification and evaluation of an infertility-associated ZP3 epitope from the marsupial brushtail possum (Trichosurus vulpecula).

ID: 1761956

Description: epitope description:GPLVLSEAENGP antigen name:Zona pellucida 3 protein host organism:Trichosurus vulpecula

Association of IL-10 level and IL-10 promoter SNPs with specific antibodies in penicillin-allergic patients.

ID: 1762130

Description: epitope description:benzylpenicilloyl group host organism:Homo sapiens

Association of IL-10 level and IL-10 promoter SNPs with specific antibodies in penicillin-allergic patients.

ID: 1762132

Description: epitope description:phenoxymethylpenicilloyl group host organism:Homo sapiens

Association of IL-10 level and IL-10 promoter SNPs with specific antibodies in penicillin-allergic patients.

ID: 1762136

Description: epitope description:amoxicilloyl group host organism:Homo sapiens

Association of IL-10 level and IL-10 promoter SNPs with specific antibodies in penicillin-allergic patients.

ID: 1762140

Description: epitope description:phenoxymethylpenicillanyl group host organism:Homo sapiens

Association of IL-10 level and IL-10 promoter SNPs with specific antibodies in penicillin-allergic patients.

ID: 1762145

Description: epitope description:amoxicillanyl group host organism:Homo sapiens

Biophysical determinants of toluene diisocyanate antigenicity associated with exposure and asthma.

ID: 1762146

Description: epitope description:toluene 2,4-diisocyanate host organism:Homo sapiens

Biophysical determinants of toluene diisocyanate antigenicity associated with exposure and asthma.

ID: 1762156

Description: epitope description:toluene 2,4-diisocyanate host organism:Homo sapiens

Biophysical determinants of toluene diisocyanate antigenicity associated with exposure and asthma.

ID: 1762158

Description: epitope description:toluene 2,4-diisocyanate host organism:Homo sapiens

Induction of thyroiditis in mice with thyrotropin receptor lacking serologically dominant regions.

ID: 1762204

Description: epitope description:PDLTKVYSTDIFFILEITDN antigen name:Thyrotropin receptor host organism:Mus musculus BALB/c

Induction of thyroiditis in mice with thyrotropin receptor lacking serologically dominant regions.

ID: 1762215

Description: epitope description:QSLRQRKSVNALNSPLHQEY antigen name:Thyrotropin receptor host organism:Mus musculus BALB/c

Induction of thyroiditis in mice with thyrotropin receptor lacking serologically dominant regions.

ID: 1762217

Description: epitope description:YKEKSKFQDTHNNAHYYVFF antigen name:Thyrotropin receptor host organism:Mus musculus BALB/c

Induction of thyroiditis in mice with thyrotropin receptor lacking serologically dominant regions.

ID: 1762219

Description: epitope description:YYVFFEEQEDEIIGFGQELK antigen name:Thyrotropin receptor host organism:Mus musculus BALB/c

Induction of thyroiditis in mice with thyrotropin receptor lacking serologically dominant regions.

ID: 1762222

Description: epitope description:DSHYDYTICGDSEDMVCTPK antigen name:Thyrotropin receptor host organism:Mus musculus BALB/c

Production and characterization of monoclonal and polyclonal antibodies against thyrotropin-releasing hormone.

ID: 1762474

Description: epitope description:EHP + PYRE(E1) antigen name:Pro-thyrotropin-releasing hormone host organism:Mus musculus BALB/c antibody name:83-7B5-A1, 83-6B6-A1...

Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

ID: 1762626

Description: epitope description:PLNEKQIA antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

ID: 1762628

Description: epitope description:NEKQIANS antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

ID: 1762629

Description: epitope description:EKQIANSQ antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

ID: 1762634

Description: epitope description:NSQDGYVW antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens