Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Generation and characterization of monoclonal antibodies against multiple epitopes on the C-terminal half of envelope gp46 of human T-cell leukemia vi...

    ID: 1484165

    Description: epitope description:TPLLYPSLALPAPHLTLPFNWTHCFDPQIQ antigen name:Envelope glycoprotein gp62 host organism:Rattus norvegicus Lewis antibody name:REY11, ...

    Publication: 1698731;

  2. Iscom immunization with synthetic peptides representing measles virus hemagglutinin.

    ID: 1484174

    Description: epitope description:GMGVSCTVTREDGTNRR antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus

    Publication: 1529642;

  3. Generation and characterization of monoclonal antibodies against multiple epitopes on the C-terminal half of envelope gp46 of human T-cell leukemia vi...

    ID: 1484179

    Description: epitope description:PCHNSLILPPFSLSPVPTLGSRSRR antigen name:Envelope glycoprotein gp62 host organism:Rattus norvegicus WKAH antibody name:REY30

    Publication: 1698731;

  4. Iscom immunization with synthetic peptides representing measles virus hemagglutinin.

    ID: 1484186

    Description: epitope description:KSNHNNVYWLTIPPMKNLALGVINTL antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus

    Publication: 1529642;

  5. Iscom immunization with synthetic peptides representing measles virus hemagglutinin.

    ID: 1484188

    Description: epitope description:GMGVSCTVTREDGTNRR antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus

    Publication: 1529642;

  6. Iscom immunization with synthetic peptides representing measles virus hemagglutinin.

    ID: 1484189

    Description: epitope description:PTTRTDDKLR antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus

    Publication: 1529642;

  7. Mapping of antigenic sites on the major inner capsid protein of avian rotavirus using an Escherichia coli expression system.

    ID: 1484195

    Description: epitope description:FQTGGIGNLPVRNWTFDFGTL antigen name:Intermediate capsid protein VP6 host organism:Mus musculus BALB/c antibody name:P3-29

    Publication: 8973528;

  8. Rational dissection of binding surfaces for mimicking of discontinuous antigenic sites.

    ID: 1484198

    Description: epitope description:CTGDKENVYPSQNFGHMHKSEKDRGC host organism:Mus musculus antibody name:2A12, 2E5,3E9, 5C4

    Publication: 16931331;

  9. Rational dissection of binding surfaces for mimicking of discontinuous antigenic sites.

    ID: 1484206

    Description: epitope description:CTGDKENVYPSQNFGHMHKSEKDRGC host organism:Cavia porcellus Duncan-Hartley

    Publication: 16931331;

  10. Iscom immunization with synthetic peptides representing measles virus hemagglutinin.

    ID: 1484217

    Description: epitope description:GMYGGTYLVEKP antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus

    Publication: 1529642;

  11. Iscom immunization with synthetic peptides representing measles virus hemagglutinin.

    ID: 1484219

    Description: epitope description:LKIKIASGFGPLITHGSGMDLYK antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus

    Publication: 1529642;

  12. Rational dissection of binding surfaces for mimicking of discontinuous antigenic sites.

    ID: 1484220

    Description: epitope description:CTGDKENVYPSQNFGHMHKSEKDRGC host organism:Cavia porcellus Duncan-Hartley

    Publication: 16931331;

  13. The effects of a flanking sequence on the immune response to a B and a T cell epitope from the fusion protein of measles virus.

    ID: 1484239

    Description: epitope description:GDINKVLEKLGYS antigen name:Fusion glycoprotein F0 host organism:Mus musculus C57BL/6

    Publication: 1379626;

  14. The effects of a flanking sequence on the immune response to a B and a T cell epitope from the fusion protein of measles virus.

    ID: 1484246

    Description: epitope description:GDINKVLEKLGYSGGDLLG antigen name:Fusion glycoprotein F0 host organism:Mus musculus CBA

    Publication: 1379626;

  15. The effects of a flanking sequence on the immune response to a B and a T cell epitope from the fusion protein of measles virus.

    ID: 1484247

    Description: epitope description:GDINKVLEKLGYSGGDLLG antigen name:Fusion glycoprotein F0 host organism:Mus musculus A/J

    Publication: 1379626;

  16. The effects of a flanking sequence on the immune response to a B and a T cell epitope from the fusion protein of measles virus.

    ID: 1484249

    Description: epitope description:GDINKVLEKLGYSGGDLLG antigen name:Fusion glycoprotein F0 host organism:Mus musculus Swiss

    Publication: 1379626;

  17. The effects of a flanking sequence on the immune response to a B and a T cell epitope from the fusion protein of measles virus.

    ID: 1484250

    Description: epitope description:GDINKVLEKLGYSGGDLLG antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/c

    Publication: 1379626;

  18. The effects of a flanking sequence on the immune response to a B and a T cell epitope from the fusion protein of measles virus.

    ID: 1484255

    Description: epitope description:GDINKVLEKLGYS antigen name:Fusion glycoprotein F0 host organism:Mus musculus A/J

    Publication: 1379626;

  19. The effects of a flanking sequence on the immune response to a B and a T cell epitope from the fusion protein of measles virus.

    ID: 1484264

    Description: epitope description:GDINKVLEKLGYSGGDLLG antigen name:Fusion glycoprotein F0 host organism:Mus musculus Swiss

    Publication: 1379626;

  20. The effects of a flanking sequence on the immune response to a B and a T cell epitope from the fusion protein of measles virus.

    ID: 1484266

    Description: epitope description:GDINKVLEKLGYS antigen name:Fusion glycoprotein F0 host organism:Mus musculus C57BL/6

    Publication: 1379626;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston