Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

    ID: 1762636

    Description: epitope description:QDGYVWQV antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

    Publication: 11251884;

  2. Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

    ID: 1762644

    Description: epitope description:TDMNRLHR antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

    Publication: 11251884;

  3. Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

    ID: 1762645

    Description: epitope description:DMNRLHRF antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

    Publication: 11251884;

  4. Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

    ID: 1762656

    Description: epitope description:GSEGGTYY antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

    Publication: 11251884;

  5. Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

    ID: 1762662

    Description: epitope description:YYIKEQKL antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

    Publication: 11251884;

  6. Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

    ID: 1762664

    Description: epitope description:IKEQKLGL antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

    Publication: 11251884;

  7. Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

    ID: 1762685

    Description: epitope description:RGCEVIQE antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

    Publication: 11251884;

  8. Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

    ID: 1762686

    Description: epitope description:GCEVIQEI antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

    Publication: 11251884;

  9. Catalytic domain of PDC-E2 contains epitopes recognized by antimitochondrial antibodies in primary biliary cirrhosis.

    ID: 1717479

    Description: epitope description:YRPTEVTDLKPQVPPPTPPPVAAVP antigen name:Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, ...

    Publication: 20180236;

  10. Catalytic domain of PDC-E2 contains epitopes recognized by antimitochondrial antibodies in primary biliary cirrhosis.

    ID: 1717482

    Description: epitope description:VDPLAKKLAVEKGIDLTQVKGTGPD antigen name:Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, ...

    Publication: 20180236;

  11. Catalytic domain of PDC-E2 contains epitopes recognized by antimitochondrial antibodies in primary biliary cirrhosis.

    ID: 1717488

    Description: epitope description:LVRKELNKILEGRSKISVNDFIIKA antigen name:Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, ...

    Publication: 20180236;

  12. Catalytic domain of PDC-E2 contains epitopes recognized by antimitochondrial antibodies in primary biliary cirrhosis.

    ID: 1717493

    Description: epitope description:VVSLATKAREGKLQPHEFQGGTFTISNL antigen name:Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase comple...

    Publication: 20180236;

  13. Fine specificity of autoantibodies induced by mouse hepatitis virus A59.

    ID: 1717508

    Description: epitope description:DSDFPIQNLPYGVFS antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c

    Publication: 19811085;

  14. Fine specificity of autoantibodies induced by mouse hepatitis virus A59.

    ID: 1717520

    Description: epitope description:DFPIQNLPYGVFSTQ antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c

    Publication: 19811085;

  15. Fine specificity of autoantibodies induced by mouse hepatitis virus A59.

    ID: 1717524

    Description: epitope description:QNLPYGVFSTQSNPK antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c

    Publication: 19811085;

  16. Fine specificity of autoantibodies induced by mouse hepatitis virus A59.

    ID: 1717531

    Description: epitope description:FSTQSNPKPRIGVAI antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c

    Publication: 19811085;

  17. Fine specificity of autoantibodies induced by mouse hepatitis virus A59.

    ID: 1717540

    Description: epitope description:IGVAIGDQILDLSVI antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c

    Publication: 19811085;

  18. Fine specificity of autoantibodies induced by mouse hepatitis virus A59.

    ID: 1717541

    Description: epitope description:GVAIGDQILDLSVIK antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c

    Publication: 19811085;

  19. Fine specificity of autoantibodies induced by mouse hepatitis virus A59.

    ID: 1717552

    Description: epitope description:QGDGYRVGFGQCAGK antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c

    Publication: 19811085;

  20. Fine specificity of autoantibodies induced by mouse hepatitis virus A59.

    ID: 1717556

    Description: epitope description:YRVGFGQCAGKVLPA antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c

    Publication: 19811085;

  21. Fine specificity of autoantibodies induced by mouse hepatitis virus A59.

    ID: 1717560

    Description: epitope description:FGQCAGKVLPALSPA antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c

    Publication: 19811085;

  22. Induction of native protein reactive antibodies by immunization with peptides containing linear B-cell epitopes defined by anti-porcine ZP3 beta monoc...

    ID: 1717562

    Description: epitope description:QPVWQDEGQRLRPSK antigen name:Zona pellucida sperm-binding protein 3 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9234211;

  23. Induction of native protein reactive antibodies by immunization with peptides containing linear B-cell epitopes defined by anti-porcine ZP3 beta monoc...

    ID: 1717571

    Description: epitope description:QPVWQDEGQRLRPSK antigen name:Zona pellucida sperm-binding protein 3 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9234211;

  24. Breaking tolerance to the natural human liver autoantigen cytochrome P450 2D6 by virus infection.

    ID: 1717572

    Description: epitope description:WDPAQPPRD antigen name:Cytochrome P450 2D6 host organism:Mus musculus FVB

    Publication: 18474629;

  25. Induction of native protein reactive antibodies by immunization with peptides containing linear B-cell epitopes defined by anti-porcine ZP3 beta monoc...

    ID: 1717578

    Description: epitope description:ASSAFKAPRPGPETLQFT antigen name:Zona pellucida sperm-binding protein 3 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9234211;

  26. Induction of native protein reactive antibodies by immunization with peptides containing linear B-cell epitopes defined by anti-porcine ZP3 beta monoc...

    ID: 1717579

    Description: epitope description:PVEGPAVICRCC antigen name:Zona pellucida sperm-binding protein 3 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9234211;

  27. Induction of native protein reactive antibodies by immunization with peptides containing linear B-cell epitopes defined by anti-porcine ZP3 beta monoc...

    ID: 1717581

    Description: epitope description:FSEEKLVFSLRLMEEN antigen name:Zona pellucida sperm-binding protein 3 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9234211;

  28. Autoantibodies in lichen planus pemphigoides react with a novel epitope within the C-terminal NC16A domain of BP180.

    ID: 1717589

    Description: epitope description:EEVRKLKARVDELERIRR antigen name:Collagen alpha-1(XVII) chain host organism:Homo sapiens

    Publication: 10417629;

  29. Autoantibodies in lichen planus pemphigoides react with a novel epitope within the C-terminal NC16A domain of BP180.

    ID: 1717590

    Description: epitope description:DSMDRIEKDRLQGMAPAAG antigen name:Collagen alpha-1(XVII) chain host organism:Homo sapiens

    Publication: 10417629;

  30. Autoantibodies in lichen planus pemphigoides react with a novel epitope within the C-terminal NC16A domain of BP180.

    ID: 1717592

    Description: epitope description:KDRLQGMAPAAGAD antigen name:Collagen alpha-1(XVII) chain host organism:Homo sapiens

    Publication: 10417629;

  31. Structure-function studies of S-antigen: use of proteases to reveal a dominant uveitogenic site.

    ID: 1717601

    Description: epitope description:RERRGIALD antigen name:S-arrestin host organism:Mus musculus antibody name:C10C10

    Publication: 1723632;

  32. Structure-function studies of S-antigen: use of proteases to reveal a dominant uveitogenic site.

    ID: 1717604

    Description: epitope description:NLASSTIIKE antigen name:S-arrestin host organism:Mus musculus antibody name:H11A2

    Publication: 1723632;

  33. Identification of linear surface epitopes on the guinea pig sperm membrane protein PH-20.

    ID: 1717611

    Description: epitope description:DILFYMPTDSVGLAVIDWEEWRPTWT antigen name:Hyaluronidase PH-20 host organism:Cavia porcellus Hartley

    Publication: 10374924;

  34. Identification of linear surface epitopes on the guinea pig sperm membrane protein PH-20.

    ID: 1717613

    Description: epitope description:TANNICIDAVLNFPSLDDDDE antigen name:Hyaluronidase PH-20 host organism:Cavia porcellus Hartley

    Publication: 10374924;

  35. Identification of linear surface epitopes on the guinea pig sperm membrane protein PH-20.

    ID: 1717615

    Description: epitope description:TANNICIDAVLNFPSLDDDDE antigen name:Hyaluronidase PH-20 host organism:Cavia porcellus Hartley

    Publication: 10374924;

  36. Identification of linear surface epitopes on the guinea pig sperm membrane protein PH-20.

    ID: 1717617

    Description: epitope description:DILFYMPTDSVGLAVIDWEEWRPTWT antigen name:Hyaluronidase PH-20 host organism:Cavia porcellus Hartley

    Publication: 10374924;

  37. Identification of linear surface epitopes on the guinea pig sperm membrane protein PH-20.

    ID: 1717618

    Description: epitope description:DILFYMPTDSVGLAVIDWEEWRPTWT antigen name:Hyaluronidase PH-20 host organism:Cavia porcellus Hartley

    Publication: 10374924;

  38. Identification of linear surface epitopes on the guinea pig sperm membrane protein PH-20.

    ID: 1717625

    Description: epitope description:TANNICIDAVLNFPSLDDDDE antigen name:Hyaluronidase PH-20 host organism:Cavia porcellus Hartley

    Publication: 10374924;

  39. Identification of linear surface epitopes on the guinea pig sperm membrane protein PH-20.

    ID: 1717626

    Description: epitope description:TANNICIDAVLNFPSLDDDDE antigen name:Hyaluronidase PH-20 host organism:Cavia porcellus Hartley

    Publication: 10374924;

  40. Identification of linear surface epitopes on the guinea pig sperm membrane protein PH-20.

    ID: 1717636

    Description: epitope description:DILFYMPTDSVGLAVIDWEEWRPTWT antigen name:Hyaluronidase PH-20 host organism:Cavia porcellus Hartley

    Publication: 10374924;

  41. Identification of linear surface epitopes on the guinea pig sperm membrane protein PH-20.

    ID: 1717642

    Description: epitope description:DILFYMPTDSVGLAVIDWEEWRPTWT antigen name:Hyaluronidase PH-20 host organism:Cavia porcellus Hartley

    Publication: 10374924;

  42. Unaltered thyroid function in mice responding to a highly immunogenic thyrotropin receptor: implications for the establishment of a mouse model for Gr...

    ID: 1717707

    Description: epitope description:HQEEDFRVTCKDIQRIPSLPPST antigen name:Thyrotropin receptor host organism:Mus musculus BALB/c

    Publication: 7851025;

  43. Unaltered thyroid function in mice responding to a highly immunogenic thyrotropin receptor: implications for the establishment of a mouse model for Gr...

    ID: 1717710

    Description: epitope description:DEIIGFGQELKNPQEETLQAF antigen name:Thyrotropin receptor host organism:Mus musculus SJL

    Publication: 7851025;

  44. Paratope determination of the antithrombotic antibody 82D6A3 based on the crystal structure of its complex with the von Willebrand factor A3-domain.

    ID: 1717857

    Description: epitope description:I1738, T1739, T1740, I1741, D1742, P1744, W1745, N1746, D1772, F1776, R1779, M1785, H1786 antigen name:von Willebrand factor host ...

    Publication: 16314412;

  45. Modifying effects of iodine on the immunogenicity of thyroglobulin peptides.

    ID: 1717874

    Description: epitope description:EDSDARILAAAVWYYSL antigen name:Thyroglobulin host organism:Mus musculus CBA/J

    Publication: 17327138;

  46. Modifying effects of iodine on the immunogenicity of thyroglobulin peptides.

    ID: 1717880

    Description: epitope description:VWYYSLEHSTDDYAS antigen name:Thyroglobulin host organism:Mus musculus CBA/J

    Publication: 17327138;

  47. Modifying effects of iodine on the immunogenicity of thyroglobulin peptides.

    ID: 1717884

    Description: epitope description:NTTDMMIFDLIHNYNR + SCM(Y14) antigen name:Thyroglobulin host organism:Mus musculus CBA/J

    Publication: 17327138;

  48. Binding of immunoglobulin G from patients with autoimmune thyroid disease to rat sodium-iodide symporter peptides: evidence for the iodide transporter...

    ID: 1717899

    Description: epitope description:MEGAEAGARAT antigen name:Sodium/iodide cotransporter host organism:Homo sapiens

    Publication: 9292938;

  49. Binding of immunoglobulin G from patients with autoimmune thyroid disease to rat sodium-iodide symporter peptides: evidence for the iodide transporter...

    ID: 1717900

    Description: epitope description:MEGAEAGARAT antigen name:Sodium/iodide cotransporter host organism:Homo sapiens

    Publication: 9292938;

  50. Binding of immunoglobulin G from patients with autoimmune thyroid disease to rat sodium-iodide symporter peptides: evidence for the iodide transporter...

    ID: 1717916

    Description: epitope description:GGMKAVVWTD antigen name:Sodium/iodide cotransporter host organism:Homo sapiens

    Publication: 9292938;

  51. Binding of immunoglobulin G from patients with autoimmune thyroid disease to rat sodium-iodide symporter peptides: evidence for the iodide transporter...

    ID: 1717919

    Description: epitope description:GGPRNVLSLAQNHSRINLMD antigen name:Sodium/iodide cotransporter host organism:Homo sapiens

    Publication: 9292938;

  52. Binding of immunoglobulin G from patients with autoimmune thyroid disease to rat sodium-iodide symporter peptides: evidence for the iodide transporter...

    ID: 1717925

    Description: epitope description:NQAQVQRYVACHTEGKAKL antigen name:Sodium/iodide cotransporter host organism:Homo sapiens

    Publication: 9292938;

  53. Binding of immunoglobulin G from patients with autoimmune thyroid disease to rat sodium-iodide symporter peptides: evidence for the iodide transporter...

    ID: 1717928

    Description: epitope description:KDCDPLLTGRISAPDQYMPL antigen name:Sodium/iodide cotransporter host organism:Homo sapiens

    Publication: 9292938;

  54. Binding of immunoglobulin G from patients with autoimmune thyroid disease to rat sodium-iodide symporter peptides: evidence for the iodide transporter...

    ID: 1717931

    Description: epitope description:PDQYMPLLVLDIFEDLPGVP antigen name:Sodium/iodide cotransporter host organism:Homo sapiens

    Publication: 9292938;

  55. Binding of immunoglobulin G from patients with autoimmune thyroid disease to rat sodium-iodide symporter peptides: evidence for the iodide transporter...

    ID: 1717933

    Description: epitope description:EDLIKPRMPGLAPRKLVFISK antigen name:Sodium/iodide cotransporter host organism:Homo sapiens

    Publication: 9292938;

  56. Binding of immunoglobulin G from patients with autoimmune thyroid disease to rat sodium-iodide symporter peptides: evidence for the iodide transporter...

    ID: 1717939

    Description: epitope description:PGEQTMGVLPTSAAGCTNDS antigen name:Sodium/iodide cotransporter host organism:Homo sapiens

    Publication: 9292938;

  57. Binding of immunoglobulin G from patients with autoimmune thyroid disease to rat sodium-iodide symporter peptides: evidence for the iodide transporter...

    ID: 1717943

    Description: epitope description:CTNDSVLLGPPGATNASNGI antigen name:Sodium/iodide cotransporter host organism:Homo sapiens

    Publication: 9292938;

  58. Binding of immunoglobulin G from patients with autoimmune thyroid disease to rat sodium-iodide symporter peptides: evidence for the iodide transporter...

    ID: 1717947

    Description: epitope description:TGPTKRSSLGPGLLWWDLAR antigen name:Sodium/iodide cotransporter host organism:Homo sapiens

    Publication: 9292938;

  59. Binding of immunoglobulin G from patients with autoimmune thyroid disease to rat sodium-iodide symporter peptides: evidence for the iodide transporter...

    ID: 1717948

    Description: epitope description:TGPTKRSSLGPGLLWWDLAR antigen name:Sodium/iodide cotransporter host organism:Homo sapiens

    Publication: 9292938;

  60. Binding of immunoglobulin G from patients with autoimmune thyroid disease to rat sodium-iodide symporter peptides: evidence for the iodide transporter...

    ID: 1717949

    Description: epitope description:TGPTKRSSLGPGLLWWDLAR antigen name:Sodium/iodide cotransporter host organism:Homo sapiens

    Publication: 9292938;

  61. Binding of immunoglobulin G from patients with autoimmune thyroid disease to rat sodium-iodide symporter peptides: evidence for the iodide transporter...

    ID: 1717954

    Description: epitope description:TATLEESLVKGPEDIPAVTK antigen name:Sodium/iodide cotransporter host organism:Homo sapiens

    Publication: 9292938;

  62. Binding of immunoglobulin G from patients with autoimmune thyroid disease to rat sodium-iodide symporter peptides: evidence for the iodide transporter...

    ID: 1717961

    Description: epitope description:THPLYLGHDVETNL antigen name:Sodium/iodide cotransporter host organism:Homo sapiens

    Publication: 9292938;

  63. Characterization and epitope mapping of monoclonal antibodies recognizing N-terminus of Rep of porcine circovirus type 2.

    ID: 1717965

    Description: epitope description:LFDYFIVG antigen name:Replication-associated protein host organism:Mus musculus BALB/c antibody name:1C1

    Publication: 20152863;

  64. Characterization and epitope mapping of monoclonal antibodies recognizing N-terminus of Rep of porcine circovirus type 2.

    ID: 1717969

    Description: epitope description:KEGNLLIE antigen name:Replication-associated protein host organism:Mus musculus BALB/c antibody name:3D10

    Publication: 20152863;

  65. Distinct genetic pattern of mouse susceptibility to thyroiditis induced by a novel thyroglobulin peptide.

    ID: 1717986

    Description: epitope description:CSFWSKYIQTLKDADGAK antigen name:Thyroglobulin host organism:Mus musculus SJL

    Publication: 8225435;

  66. DNA prime-protein boost increased the titer, avidity and persistence of anti-Abeta antibodies in wild-type mice.

    ID: 1718002

    Description: epitope description:DAEFRHDSGYE antigen name:Amyloid beta A4 protein host organism:Mus musculus C57BL/6

    Publication: 19865176;

  67. Heterogeneity in cellular and antibody responses against thyrotropin receptor in patients with Graves' disease detected using synthetic peptides.

    ID: 1728011

    Description: epitope description:LLDLPRDLGGMGCSSPPCE antigen name:Thyrotropin receptor host organism:Homo sapiens

    Publication: 7512341;

  68. Heterogeneity in cellular and antibody responses against thyrotropin receptor in patients with Graves' disease detected using synthetic peptides.

    ID: 1733014

    Description: epitope description:HQEEDFRVTCKDIQR antigen name:Thyrotropin receptor host organism:Homo sapiens

    Publication: 7512341;

  69. Heterogeneity in cellular and antibody responses against thyrotropin receptor in patients with Graves' disease detected using synthetic peptides.

    ID: 1733022

    Description: epitope description:EYEENLGDSIVGYKEKSKFQD antigen name:Thyrotropin receptor host organism:Homo sapiens

    Publication: 7512341;

  70. Heterogeneity in cellular and antibody responses against thyrotropin receptor in patients with Graves' disease detected using synthetic peptides.

    ID: 1733025

    Description: epitope description:GYKEKSKFQDTHNNA antigen name:Thyrotropin receptor host organism:Homo sapiens

    Publication: 7512341;

  71. Heterogeneity in cellular and antibody responses against thyrotropin receptor in patients with Graves' disease detected using synthetic peptides.

    ID: 1733034

    Description: epitope description:YYVFFEEQEDEIIGF antigen name:Thyrotropin receptor host organism:Homo sapiens

    Publication: 7512341;

  72. Heterogeneity in cellular and antibody responses against thyrotropin receptor in patients with Graves' disease detected using synthetic peptides.

    ID: 1733038

    Description: epitope description:EEQEDEIIGFGQELKN antigen name:Thyrotropin receptor host organism:Homo sapiens

    Publication: 7512341;

  73. Heterogeneity in cellular and antibody responses against thyrotropin receptor in patients with Graves' disease detected using synthetic peptides.

    ID: 1733046

    Description: epitope description:PQEETLQAFDSHYDYT antigen name:Thyrotropin receptor host organism:Homo sapiens

    Publication: 7512341;

  74. A region on the human thyrotropin receptor which can induce antibodies that inhibit thyrotropin-mediated activation of in vitro thyroid cell function ...

    ID: 1735741

    Description: epitope description:HQEEDFRVTCKDIQR antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7980849;

  75. A region on the human thyrotropin receptor which can induce antibodies that inhibit thyrotropin-mediated activation of in vitro thyroid cell function ...

    ID: 1735742

    Description: epitope description:HQEEDFRVTCKDIQR antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7980849;

  76. A region on the human thyrotropin receptor which can induce antibodies that inhibit thyrotropin-mediated activation of in vitro thyroid cell function ...

    ID: 1735744

    Description: epitope description:NALNSPLHQEYEENL antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7980849;

  77. A region on the human thyrotropin receptor which can induce antibodies that inhibit thyrotropin-mediated activation of in vitro thyroid cell function ...

    ID: 1735745

    Description: epitope description:NALNSPLHQEYEENL antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7980849;

  78. A region on the human thyrotropin receptor which can induce antibodies that inhibit thyrotropin-mediated activation of in vitro thyroid cell function ...

    ID: 1735747

    Description: epitope description:EYEENLGDSIVGYKEKSKFQD antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7980849;

  79. A region on the human thyrotropin receptor which can induce antibodies that inhibit thyrotropin-mediated activation of in vitro thyroid cell function ...

    ID: 1735751

    Description: epitope description:GYKEKSKFQDTHNNA antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7980849;

  80. A region on the human thyrotropin receptor which can induce antibodies that inhibit thyrotropin-mediated activation of in vitro thyroid cell function ...

    ID: 1735752

    Description: epitope description:GYKEKSKFQDTHNNA antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7980849;

  81. A region on the human thyrotropin receptor which can induce antibodies that inhibit thyrotropin-mediated activation of in vitro thyroid cell function ...

    ID: 1735763

    Description: epitope description:EIIGFGQELKNPQEE antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7980849;

  82. A region on the human thyrotropin receptor which can induce antibodies that inhibit thyrotropin-mediated activation of in vitro thyroid cell function ...

    ID: 1735770

    Description: epitope description:TLQAFDSHYDYTICGDSKDMV antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7980849;

  83. A region on the human thyrotropin receptor which can induce antibodies that inhibit thyrotropin-mediated activation of in vitro thyroid cell function ...

    ID: 1735775

    Description: epitope description:YYVFFEEQEDEIIGF antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7980849;

  84. Proteomic definition of a desmoglein linear determinant common to Pemphigus vulgaris and Pemphigus foliaceous.

    ID: 1735780

    Description: epitope description:EEMTMQQAK antigen name:Desmoglein-3 host organism:Homo sapiens

    Publication: 16925820;

  85. Proteomic definition of a desmoglein linear determinant common to Pemphigus vulgaris and Pemphigus foliaceous.

    ID: 1735781

    Description: epitope description:REWVKFAKPCRE antigen name:Desmoglein-3 host organism:Homo sapiens

    Publication: 16925820;

  86. Proteomic definition of a desmoglein linear determinant common to Pemphigus vulgaris and Pemphigus foliaceous.

    ID: 1735784

    Description: epitope description:REWVKFAKPCRE antigen name:Desmoglein-3 host organism:Homo sapiens

    Publication: 16925820;

  87. Site-directed mutagenesis of a portion of the extracellular domain of the rat thyrotropin receptor important in autoimmune thyroid disease and nonhomo...

    ID: 1735841

    Description: epitope description:TLQAFDSHYDYTVCGDNEDMV antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus

    Publication: 1655787;

  88. Amino acid residues 196-225 of LcrV represent a plague protective epitope.

    ID: 1735878

    Description: epitope description:KNLYGYTDEEIFKASAEYKILEKMPQTTIQ antigen name:Virulence-associated V antigen host organism:Mus musculus BALB/c

    Publication: 20005318;

  89. Amino acid residues 196-225 of LcrV represent a plague protective epitope.

    ID: 1735902

    Description: epitope description:KNLYGYTDEEIFKASAEYKILEKMPQTTIQ antigen name:Virulence-associated V antigen host organism:Mus musculus BALB/c antibody name:BA5

    Publication: 20005318;

  90. Epitope mapping of six monoclonal antibodies recognizing the Shigella dysenteriae type 1 O-antigenic repeating unit expressed in Escherichia coli K-12...

    ID: 1735974

    Description: epitope description:alpha-L-Rhap-(1->3)-alpha-L-Rhap-(1->2)-alpha-D-Galp antigen name:lipopolysaccharide host organism:Rattus norvegicus LOU/C antibod...

    Publication: 7520112;

  91. Identification of epitopes and affinity purification of thyroid stimulating auto-antibodies using synthetic human TSH receptor peptides.

    ID: 1735986

    Description: epitope description:NGFTSVQGYAFNGTKLDAVY antigen name:Thyrotropin receptor host organism:Homo sapiens

    Publication: 7524706;

  92. Identification of epitopes and affinity purification of thyroid stimulating auto-antibodies using synthetic human TSH receptor peptides.

    ID: 1735989

    Description: epitope description:DVSQTSVTALPSKGLEHLKE antigen name:Thyrotropin receptor host organism:Homo sapiens

    Publication: 7524706;

  93. Identification of epitopes and affinity purification of thyroid stimulating auto-antibodies using synthetic human TSH receptor peptides.

    ID: 1735991

    Description: epitope description:KLPLSLSFLHLTRADLSYPS antigen name:Thyrotropin receptor host organism:Homo sapiens

    Publication: 7524706;

  94. Identification of epitopes and affinity purification of thyroid stimulating auto-antibodies using synthetic human TSH receptor peptides.

    ID: 1736001

    Description: epitope description:DLYTHSEYYNHAIDWQTGPGC antigen name:Thyrotropin receptor host organism:Homo sapiens

    Publication: 7524706;

  95. Identification of epitopes and affinity purification of thyroid stimulating auto-antibodies using synthetic human TSH receptor peptides.

    ID: 1736003

    Description: epitope description:NKPLITVTNSKY antigen name:Thyroglobulin host organism:Homo sapiens

    Publication: 7524706;

  96. Proteomic definition of a desmoglein linear determinant common to Pemphigus vulgaris and Pemphigus foliaceous.

    ID: 1736014

    Description: epitope description:QVINVREG antigen name:Desmoglein-3 host organism:Homo sapiens

    Publication: 16925820;

  97. Proteomic definition of a desmoglein linear determinant common to Pemphigus vulgaris and Pemphigus foliaceous.

    ID: 1736016

    Description: epitope description:NRYTGPYT antigen name:Desmoglein-3 host organism:Homo sapiens

    Publication: 16925820;

  98. Neutralizing epitopes of the SARS-CoV S-protein cluster independent of repertoire, antigen structure or mAb technology.

    ID: 1736950

    Description: epitope description:ADQLTPAWR antigen name:Spike glycoprotein host organism:Mus musculus antibody name:F26G8

    Publication: 20168090;

  99. Neutralizing epitopes of the SARS-CoV S-protein cluster independent of repertoire, antigen structure or mAb technology.

    ID: 1736969

    Description: epitope description:TTGIGYQ antigen name:Spike glycoprotein host organism:Mus musculus antibody name:F26G19

    Publication: 20168090;

  100. Neutralizing epitopes of the SARS-CoV S-protein cluster independent of repertoire, antigen structure or mAb technology.

    ID: 1736972

    Description: epitope description:TTGIGYQ antigen name:Spike glycoprotein host organism:Mus musculus antibody name:F26G19

    Publication: 20168090;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston