Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Epitope analysis of antibodies in Japanese to human cytomegalovirus phosphoprotein 150 with synthetic peptides.

    ID: 1382593

    Description: epitope description:NVPAGAGAAILTPTP antigen name:Tegument protein pp150 host organism:Homo sapiens

    Publication: 12506979;

  2. Epitope analysis of antibodies in Japanese to human cytomegalovirus phosphoprotein 150 with synthetic peptides.

    ID: 1382596

    Description: epitope description:GAAILTPTPVNPSTA antigen name:Tegument protein pp150 host organism:Homo sapiens

    Publication: 12506979;

  3. Epitope analysis of antibodies in Japanese to human cytomegalovirus phosphoprotein 150 with synthetic peptides.

    ID: 1382603

    Description: epitope description:APAPAPTPTFAGTQT antigen name:Tegument protein pp150 host organism:Homo sapiens

    Publication: 12506979;

  4. Epitope analysis of antibodies in Japanese to human cytomegalovirus phosphoprotein 150 with synthetic peptides.

    ID: 1382606

    Description: epitope description:TPTFAGTQTPVNGNS antigen name:Tegument protein pp150 host organism:Homo sapiens

    Publication: 12506979;

  5. Epitope analysis of antibodies in Japanese to human cytomegalovirus phosphoprotein 150 with synthetic peptides.

    ID: 1382608

    Description: epitope description:AGTQTPVNGNSPWAP antigen name:Tegument protein pp150 host organism:Homo sapiens

    Publication: 12506979;

  6. Epitope analysis of antibodies in Japanese to human cytomegalovirus phosphoprotein 150 with synthetic peptides.

    ID: 1382618

    Description: epitope description:GNSPWAPTAPLPGDM antigen name:Tegument protein pp150 host organism:Homo sapiens

    Publication: 12506979;

  7. Epitope analysis of antibodies in Japanese to human cytomegalovirus phosphoprotein 150 with synthetic peptides.

    ID: 1382620

    Description: epitope description:WAPTAPLPGDMNPAN antigen name:Tegument protein pp150 host organism:Homo sapiens

    Publication: 12506979;

  8. Epitope analysis of antibodies in Japanese to human cytomegalovirus phosphoprotein 150 with synthetic peptides.

    ID: 1382621

    Description: epitope description:PTAPLPGDMNPANWP antigen name:Tegument protein pp150 host organism:Homo sapiens

    Publication: 12506979;

  9. Epitope analysis of antibodies in Japanese to human cytomegalovirus phosphoprotein 150 with synthetic peptides.

    ID: 1382623

    Description: epitope description:LPGDMNPANWPRERA antigen name:Tegument protein pp150 host organism:Homo sapiens

    Publication: 12506979;

  10. Humoral and cell-mediated immune responses to the Plasmodium falciparum antigens PF155/RESA and CS protein: seasonal variations in a population recent...

    ID: 1382648

    Description: epitope description:NANPNANPNANPNANPNANP antigen name:Circumsporozoite (CS) protein host organism:Homo sapiens

    Publication: 2221217;

  11. Peptide based vaccine design: synthesis and immunological characterization of branched polypeptide conjugates comprising the 276-284 immunodominant ep...

    ID: 1382658

    Description: epitope description:LEDPVG antigen name:Envelope glycoprotein D host organism:Mus musculus C57BL/6

    Publication: 11931583;

  12. Peptide based vaccine design: synthesis and immunological characterization of branched polypeptide conjugates comprising the 276-284 immunodominant ep...

    ID: 1382659

    Description: epitope description:SALLED antigen name:Envelope glycoprotein D host organism:Mus musculus BALB/c

    Publication: 11931583;

  13. Peptide based vaccine design: synthesis and immunological characterization of branched polypeptide conjugates comprising the 276-284 immunodominant ep...

    ID: 1382661

    Description: epitope description:SALLED antigen name:Envelope glycoprotein D host organism:Mus musculus C57BL/6

    Publication: 11931583;

  14. Exploring antibody polyspecificity using synthetic combinatorial libraries.

    ID: 1382696

    Description: epitope description:SSTSYNRGDSTFESK antigen name:Fibrinogen alpha chain host organism:Mus musculus antibody name:LJ-134B29

    Publication: 9238630;

  15. Exploring antibody polyspecificity using synthetic combinatorial libraries.

    ID: 1382705

    Description: epitope description:LHNNEAGRTTVFS antigen name:Proto-oncogene Wnt-1 host organism:Mus musculus antibody name:222-35C8

    Publication: 9238630;

  16. Discrimination of hepatitis B virus (HBV) subtypes using monoclonal antibodies to the PreS1 and PreS2 domains of the viral envelope.

    ID: 1382732

    Description: epitope description:MQWNSTAFHQTLQDPRVRGLYLPAGG antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:50-80, 116-183, 55-...

    Publication: 1693248;

  17. Discrimination of hepatitis B virus (HBV) subtypes using monoclonal antibodies to the PreS1 and PreS2 domains of the viral envelope.

    ID: 1382794

    Description: epitope description:TVNPVLTTASPLSSIFSRIGDPALN antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:128-603

    Publication: 1693248;

  18. Liposome-entrapped T-cell peptide provides help for a co-entrapped B-cell peptide to overcome genetic restriction in mice and induce immunological mem...

    ID: 1382990

    Description: epitope description:NLSVPNPLGFLPDHQLDPAFGANSTNPWDFNPC antigen name:Large envelope protein host organism:Mus musculus SJL

    Publication: 7508417;

  19. Differential host-dependent expression of alpha-galactosyl epitopes on viral glycoproteins: a study of eastern equine encephalitis virus as a model.

    ID: 1383000

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group antigen name:N-glycan host organism:Homo sapiens

    Publication: 7513744;

  20. Epitope mapping of a single repetitive unit of the B13 Trypanosoma cruzi antigen as fusions to Escherichia coli LamB protein.

    ID: 1409464

    Description: epitope description:FGQAAAGDKPSP antigen name:Surface antigen 2 (CA-2), putative host organism:Oryctolagus cuniculus New Zealand White antibody name:R...

    Publication: 15183869;

  21. Determinant analysis of IgE and IgG4 antibodies and T cells specific for bovine alpha(s)1-casein from the same patients allergic to cow's milk: existe...

    ID: 1409466

    Description: epitope description:RPKHPIKHQGLPQEVLNENL antigen name:Bos d 9 host organism:Homo sapiens antibody name:patient sera

    Publication: 9600504;

  22. Determinant analysis of IgE and IgG4 antibodies and T cells specific for bovine alpha(s)1-casein from the same patients allergic to cow's milk: existe...

    ID: 1409467

    Description: epitope description:LNENLLRFFVAPFPQVFGKE antigen name:Bos d 9 host organism:Homo sapiens antibody name:patient sera

    Publication: 9600504;

  23. Determinant analysis of IgE and IgG4 antibodies and T cells specific for bovine alpha(s)1-casein from the same patients allergic to cow's milk: existe...

    ID: 1409474

    Description: epitope description:HSMKEGIHAQQKEPMIGVNQ antigen name:Bos d 9 host organism:Homo sapiens antibody name:patient sera

    Publication: 9600504;

  24. Determinant analysis of IgE and IgG4 antibodies and T cells specific for bovine alpha(s)1-casein from the same patients allergic to cow's milk: existe...

    ID: 1409486

    Description: epitope description:EAESISSSEEIVPNSVEQKH antigen name:Bos d 9 host organism:Homo sapiens antibody name:patient sera

    Publication: 9600504;

  25. Determinant analysis of IgE and IgG4 antibodies and T cells specific for bovine alpha(s)1-casein from the same patients allergic to cow's milk: existe...

    ID: 1409489

    Description: epitope description:SESTEGDAMEDIKQMEAESI antigen name:Bos d 9 host organism:Homo sapiens antibody name:sera

    Publication: 9600504;

  26. Determinant analysis of IgE and IgG4 antibodies and T cells specific for bovine alpha(s)1-casein from the same patients allergic to cow's milk: existe...

    ID: 1409494

    Description: epitope description:YLGYLEQLLRLKKYKVPQLE antigen name:Bos d 9 host organism:Homo sapiens antibody name:sera

    Publication: 9600504;

  27. Determinant analysis of IgE and IgG4 antibodies and T cells specific for bovine alpha(s)1-casein from the same patients allergic to cow's milk: existe...

    ID: 1409495

    Description: epitope description:VPQLEIVPNSAEERLHSMKE antigen name:Bos d 9 host organism:Homo sapiens antibody name:patient sera

    Publication: 9600504;

  28. Determinant analysis of IgE and IgG4 antibodies and T cells specific for bovine alpha(s)1-casein from the same patients allergic to cow's milk: existe...

    ID: 1409497

    Description: epitope description:HSMKEGIHAQQKEPMIGVNQ antigen name:Bos d 9 host organism:Homo sapiens antibody name:patient sera

    Publication: 9600504;

  29. Determinant analysis of IgE and IgG4 antibodies and T cells specific for bovine alpha(s)1-casein from the same patients allergic to cow's milk: existe...

    ID: 1409498

    Description: epitope description:HSMKEGIHAQQKEPMIGVNQ antigen name:Bos d 9 host organism:Homo sapiens antibody name:sera

    Publication: 9600504;

  30. Determinant analysis of IgE and IgG4 antibodies and T cells specific for bovine alpha(s)1-casein from the same patients allergic to cow's milk: existe...

    ID: 1409499

    Description: epitope description:IGVNQELAYFYPELFRQFYQ antigen name:Bos d 9 host organism:Homo sapiens antibody name:patient sera

    Publication: 9600504;

  31. Vaccination by cholera toxin conjugated to a herpes simplex virus type 2 glycoprotein D peptide.

    ID: 1409528

    Description: epitope description:KYALADPSLKMADPNRFRGKNLP antigen name:Envelope glycoprotein D host organism:Mus musculus BALB/c antibody name:mouse sera

    Publication: 1383408;

  32. Chlamydia infections and heart disease linked through antigenic mimicry.

    ID: 1409538

    Description: epitope description:VLETSMAEFTSTNVIS antigen name:Large cysteine-rich periplasmic protein OmcB host organism:Mus musculus BALB/c

    Publication: 10037605;

  33. Mapping of IgE-binding epitopes on the recombinant major group I allergen of velvet grass pollen, rHol l 1.

    ID: 1409547

    Description: epitope description:AKSTWYGKPTGAGPKDNGGACGYKDVD antigen name:Hol l 1 host organism:Homo sapiens

    Publication: 9215246;

  34. Soybean glycinin G1 acidic chain shares IgE epitopes with peanut allergen Ara h 3.

    ID: 1409579

    Description: epitope description:NQEQEFLKYQQEQ antigen name:Gly m 6 host organism:Homo sapiens

    Publication: 11146387;

  35. Soybean glycinin G1 acidic chain shares IgE epitopes with peanut allergen Ara h 3.

    ID: 1409583

    Description: epitope description:QEEENEGGSILSG antigen name:Gly m 6 host organism:Homo sapiens

    Publication: 11146387;

  36. Soybean glycinin G1 acidic chain shares IgE epitopes with peanut allergen Ara h 3.

    ID: 1409584

    Description: epitope description:GGSILSGFTLEFL antigen name:Gly m 6 host organism:Homo sapiens

    Publication: 11146387;

  37. Soybean glycinin G1 acidic chain shares IgE epitopes with peanut allergen Ara h 3.

    ID: 1409586

    Description: epitope description:GFTLEFLEHAFSV antigen name:Gly m 6 host organism:Homo sapiens

    Publication: 11146387;

  38. Soybean glycinin G1 acidic chain shares IgE epitopes with peanut allergen Ara h 3.

    ID: 1409589

    Description: epitope description:NEGEDKGAIVTVK antigen name:Gly m 6 host organism:Homo sapiens

    Publication: 11146387;

  39. A chemically synthesized peptide which elicits humoral and cellular immune responses to mycobacterial antigens.

    ID: 1409668

    Description: epitope description:AKVNIKPLEDKIL antigen name:10 kDa chaperonin host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-BCG-a-P

    Publication: 3744551;

  40. A chemically synthesized peptide which elicits humoral and cellular immune responses to mycobacterial antigens.

    ID: 1409670

    Description: epitope description:AKVNIKPLEDKIL antigen name:10 kDa chaperonin host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-BCG

    Publication: 3744551;

  41. A chemically synthesized peptide which elicits humoral and cellular immune responses to mycobacterial antigens.

    ID: 1409671

    Description: epitope description:AKVNIKPLEDKIL antigen name:10 kDa chaperonin host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-H37Rv

    Publication: 3744551;

  42. A chemically synthesized peptide which elicits humoral and cellular immune responses to mycobacterial antigens.

    ID: 1409674

    Description: epitope description:AKVNIKPLEDKIL antigen name:10 kDa chaperonin host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-M. fortuitum

    Publication: 3744551;

  43. Immunization with a peptide corresponding to chlamydial heat shock protein 60 increases the humoral immune response in C3H mice to a peptide represent...

    ID: 1409695

    Description: epitope description:SATAIFDTTTLNPTIAGAGDVKASAEGQLG antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/6

    Publication: 10225836;

  44. How reliable is the structural prediction of IgE-binding epitopes of allergens? The case study of plant lipid transfer proteins.

    ID: 1409704

    Description: epitope description:RTTPDRQAA antigen name:Non-specific lipid-transfer protein host organism:Oryctolagus cuniculus

    Publication: 17059861;

  45. How reliable is the structural prediction of IgE-binding epitopes of allergens? The case study of plant lipid transfer proteins.

    ID: 1409706

    Description: epitope description:RTTPDRQAA antigen name:Non-specific lipid-transfer protein host organism:Oryctolagus cuniculus

    Publication: 17059861;

  46. Correlation between conformation and antibody binding: NMR structure of cross-reactive peptides from T. cruzi, human and L. braziliensis.

    ID: 1409748

    Description: epitope description:EEEDDDMGFGLFD antigen name:Other Trypanosoma cruzi protein host organism:Mus musculus antibody name:mAb

    Publication: 14988012;

  47. A monoclonal antibody against a carbohydrate epitope in lipopolysaccharide differentiates Chlamydophila psittaci from Chlamydophila pecorum, Chlamydop...

    ID: 1409757

    Description: epitope description:3-deoxy-alpha-D-manno-oct-2-ulopyranosonic acid antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:S6...

    Publication: 16282606;

  48. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409198

    Description: epitope description:STTTSTG antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  49. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409203

    Description: epitope description:TGPCKTC antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  50. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409206

    Description: epitope description:CKTCTTP antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  51. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409207

    Description: epitope description:KTCTTPA antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  52. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409215

    Description: epitope description:GNSMFPS antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  53. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409221

    Description: epitope description:SCCCTKP antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  54. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409222

    Description: epitope description:CCCTKPT antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  55. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409227

    Description: epitope description:PTDGNCT antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  56. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409228

    Description: epitope description:TDGNCTC antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  57. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409232

    Description: epitope description:CTCIPIP antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  58. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409237

    Description: epitope description:IPSSWAF antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  59. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409243

    Description: epitope description:FAKYLWE antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  60. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409251

    Description: epitope description:ASVRFSW antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  61. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409252

    Description: epitope description:SVRFSWL antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  62. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409253

    Description: epitope description:VRFSWLS antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  63. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409261

    Description: epitope description:LVPFVQW antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  64. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409263

    Description: epitope description:PFVQWFV antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  65. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409265

    Description: epitope description:VQWFVGL antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  66. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409272

    Description: epitope description:SPTVWLS antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  67. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409274

    Description: epitope description:TVWLSAI antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  68. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409281

    Description: epitope description:WMMWYWG antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  69. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409286

    Description: epitope description:WGPSLYS antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  70. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409293

    Description: epitope description:IVSPFIP antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  71. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409295

    Description: epitope description:SPFIPLL antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  72. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409296

    Description: epitope description:PFIPLLP antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  73. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409298

    Description: epitope description:IPLLPIF antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  74. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409299

    Description: epitope description:PLLPIFF antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  75. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409301

    Description: epitope description:LPIFFCL antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  76. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409304

    Description: epitope description:FFCLWVY antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  77. Specificity of antibodies reactive with hepatitis B surface antigen following immunization with synthetic peptides.

    ID: 1409305

    Description: epitope description:FCLWVYI antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 7508664;

  78. Identification of IgE-binding epitopes of the major peach allergen Pru p 3.

    ID: 1409308

    Description: epitope description:VSSSLAPCIP antigen name:Non-specific lipid-transfer protein host organism:Homo sapiens

    Publication: 13679821;

  79. Identification of IgE-binding epitopes of the major peach allergen Pru p 3.

    ID: 1409309

    Description: epitope description:APCIPYVRGG antigen name:Non-specific lipid-transfer protein host organism:Homo sapiens

    Publication: 13679821;

  80. Monoclonal antibodies to denatured ragweed pollen allergen Amb a I: characterization, specificity for the denatured allergen, and utilization for the ...

    ID: 1409414

    Description: epitope description:GMLATVAFNTFTDNVDQR antigen name:Amb a 1 host organism:Mus musculus BALB/c antibody name:JB1C6-5, JB3D3-3, JB4F3-5, JB5F2-2

    Publication: 2456454;

  81. A monoclonal antibody against a carbohydrate epitope in lipopolysaccharide differentiates Chlamydophila psittaci from Chlamydophila pecorum, Chlamydop...

    ID: 1409758

    Description: epitope description:3-deoxy-alpha-D-manno-oct-2-ulopyranosonic acid antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:A2...

    Publication: 16282606;

  82. A monoclonal antibody against a carbohydrate epitope in lipopolysaccharide differentiates Chlamydophila psittaci from Chlamydophila pecorum, Chlamydop...

    ID: 1409759

    Description: epitope description:alpha-Kdo-(2->8)-alpha-Kdo-(2->4)-alpha-Kdo antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:S25-23

    Publication: 16282606;

  83. A monoclonal antibody against a carbohydrate epitope in lipopolysaccharide differentiates Chlamydophila psittaci from Chlamydophila pecorum, Chlamydop...

    ID: 1409763

    Description: epitope description:alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->8)-alpha-D-Kdo-(2->4)-alpha-D-Kdo antigen name:lipopolysaccharide host organism:Mus musculus BA...

    Publication: 16282606;

  84. A synthetic glycoconjugate representing the genus-specific epitope of chlamydial lipopolysaccharide exhibits the same specificity as its natural count...

    ID: 1409777

    Description: epitope description:3-deoxy-alpha-D-manno-oct-2-ulopyranosonic acid antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:A2...

    Publication: 1372290;

  85. A synthetic glycoconjugate representing the genus-specific epitope of chlamydial lipopolysaccharide exhibits the same specificity as its natural count...

    ID: 1409778

    Description: epitope description:alpha-Kdo-(2->8)-alpha-Kdo-(2->4)-alpha-Kdo antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:S5-10

    Publication: 1372290;

  86. A synthetic glycoconjugate representing the genus-specific epitope of chlamydial lipopolysaccharide exhibits the same specificity as its natural count...

    ID: 1409783

    Description: epitope description:alpha-Kdo-(2->8)-alpha-Kdo antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:S25-27, S25-2

    Publication: 1372290;

  87. Elimination of immune tolerance to hepatitis virus in an animal model.

    ID: 1409786

    Description: epitope description:TPEEDQDAREAFRRYQEERPPE antigen name:Large envelope protein host organism:Anas

    Publication: 1395838;

  88. Detection of human antibodies using ""convergent"" combinatorial peptide libraries or ""mixotopes"" designed from a nonvariable antigen: application t...

    ID: 1409790

    Description: epitope description:AVDTGSGGGGQPHDTAPRGARKKQ antigen name:Capsid protein VP26 host organism:Homo sapiens

    Publication: 9924994;

  89. Production and characterization of peptide mimotopes of phenolic glycolipid-I of Mycobacterium leprae.

    ID: 1409799

    Description: epitope description:WTLGPYV host organism:Mus musculus BALB/c antibody name:III603.8

    Publication: 15094167;

  90. A synthetic glycoconjugate representing the genus-specific epitope of chlamydial lipopolysaccharide exhibits the same specificity as its natural count...

    ID: 1409817

    Description: epitope description:alpha-Kdo-(2->8)-alpha-Kdo-(2->4)-alpha-Kdo antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:L2I-6

    Publication: 1372290;

  91. Inducing tolerance by intranasal administration of long peptides in naive and primed CBA/J mice.

    ID: 1409856

    Description: epitope description:LIDTKCYKLEHPVTGCGERTEGRCLHYTVDKSKPKVYQWFDLRKY antigen name:Api m 1 host organism:Mus musculus CBA/J

    Publication: 10975871;

  92. A common epitope on major allergens from non-biting midges (Chironomidae).

    ID: 1409868

    Description: epitope description:GVTHDQLNNFR antigen name:Chi t 1 host organism:Oryctolagus cuniculus antibody name:anti-Chi t I

    Publication: 2464134;

  93. A common epitope on major allergens from non-biting midges (Chironomidae).

    ID: 1409870

    Description: epitope description:GVTHDQLNNFR antigen name:Chi t 1 host organism:Mus musculus BALB/c antibody name:mAb 5, 6, 7, 15

    Publication: 2464134;

  94. Immunization with a peptide corresponding to chlamydial heat shock protein 60 increases the humoral immune response in C3H mice to a peptide represent...

    ID: 1409872

    Description: epitope description:SATAIFDTTTLNPTIAGAGDVKASAEGQLG antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C3H/He

    Publication: 10225836;

  95. Immunization with a peptide corresponding to chlamydial heat shock protein 60 increases the humoral immune response in C3H mice to a peptide represent...

    ID: 1409910

    Description: epitope description:QYIKANSKFIGITEL antigen name:Tetanus toxin host organism:Mus musculus C57BL/6

    Publication: 10225836;

  96. Immunization with a peptide corresponding to chlamydial heat shock protein 60 increases the humoral immune response in C3H mice to a peptide represent...

    ID: 1409913

    Description: epitope description:MQWNSTTFHQTLQ antigen name:Large envelope protein host organism:Mus musculus C57BL/6

    Publication: 10225836;

  97. Immunization with a peptide corresponding to chlamydial heat shock protein 60 increases the humoral immune response in C3H mice to a peptide represent...

    ID: 1409915

    Description: epitope description:MQWNSTTFHQTLQ antigen name:Large envelope protein host organism:Mus musculus C57BL/6

    Publication: 10225836;

  98. Epitopes of herpes simplex virus type 1 glycoprotein B that bind type-common neutralizing antibodies elicit type-specific antibody-dependent cellular ...

    ID: 1410106

    Description: epitope description:APSSPGTPGVAAATQAANGG antigen name:Envelope glycoprotein B host organism:Mus musculus BALB/c antibody name:H1817

    Publication: 1380051;

  99. Epitopes of herpes simplex virus type 1 glycoprotein B that bind type-common neutralizing antibodies elicit type-specific antibody-dependent cellular ...

    ID: 1410116

    Description: epitope description:YREGSHTEHTSYAADRFKQVDGFYAR antigen name:Envelope glycoprotein B host organism:Mus musculus BALB/c antibody name:H1819

    Publication: 1380051;

  100. Epitopes of herpes simplex virus type 1 glycoprotein B that bind type-common neutralizing antibodies elicit type-specific antibody-dependent cellular ...

    ID: 1410178

    Description: epitope description:Y278 antigen name:Envelope glycoprotein B host organism:Mus musculus BALB/c antibody name:H1435

    Publication: 1380051;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston