Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. IgE antibody responses to platinum group metals: a large scale refinery survey.

    ID: 1737000

    Description: epitope description:platinum host organism:Homo sapiens

    Publication: 2936374;

  2. A novel H2A-E+ transgenic model susceptible to human but not mouse thyroglobulin-induced autoimmune thyroiditis: identification of mouse pathogenic ep...

    ID: 1737025

    Description: epitope description:HYQRLSESRSLLREA antigen name:Thyroglobulin host organism:Mus musculus

    Publication: 18489063;

  3. Identification of a cross-reactive epitope widely present in lipopolysaccharide from enterobacteria and recognized by the cross-protective monoclonal ...

    ID: 1737046

    Description: epitope description:alpha-D-Glcp-(1->3)-[L-alpha-D-Hepp-(1->7)]-L-alpha-D-Hepp-4P antigen name:lipopolysaccharide host organism:Mus musculus NZB antib...

    Publication: 12716894;

  4. Identification of a cross-reactive epitope widely present in lipopolysaccharide from enterobacteria and recognized by the cross-protective monoclonal ...

    ID: 1737047

    Description: epitope description:alpha-D-Glcp-(1->3)-[L-alpha-D-Hepp-(1->7)]-L-alpha-D-Hepp-4P antigen name:lipopolysaccharide host organism:Mus musculus NZB antib...

    Publication: 12716894;

  5. Contrasting immunopathogenic properties of highly homologous peptides from rat and human thyroglobulin.

    ID: 1737070

    Description: epitope description:CSFWSKYISSLKTSADGAK antigen name:Thyroglobulin host organism:Mus musculus SJL

    Publication: 9135553;

  6. Effect of tolerance induction to immunodominant T-cell epitopes of Sendai virus on gene expression following repeat administration to lung.

    ID: 1755029

    Description: epitope description:VYIYTRSSGWHSQLQIG antigen name:Hemagglutinin-neuraminidase host organism:Mus musculus C57BL/6

    Publication: 16319950;

  7. Random phage mimotopes recognized by monoclonal antibodies against the pyruvate dehydrogenase complex-E2 (PDC-E2).

    ID: 1755049

    Description: epitope description:APKTYVSVSGMV host organism:Mus musculus BALB/c antibody name:C355.1

    Publication: 8855289;

  8. Autoimmunogenicity of the human sperm protein Sp17 in vasectomized men and identification of linear B cell epitopes.

    ID: 1755078

    Description: epitope description:MSIPFSNTHY antigen name:Sperm surface protein Sp17 host organism:Homo sapiens

    Publication: 9022615;

  9. Autoimmunogenicity of the human sperm protein Sp17 in vasectomized men and identification of linear B cell epitopes.

    ID: 1755092

    Description: epitope description:GHIAREEAKK antigen name:Sperm surface protein Sp17 host organism:Homo sapiens

    Publication: 9022615;

  10. Autoimmunogenicity of the human sperm protein Sp17 in vasectomized men and identification of linear B cell epitopes.

    ID: 1755094

    Description: epitope description:EAKKMKTNSL antigen name:Sperm surface protein Sp17 host organism:Homo sapiens

    Publication: 9022615;

  11. Autoimmunogenicity of the human sperm protein Sp17 in vasectomized men and identification of linear B cell epitopes.

    ID: 1755097

    Description: epitope description:MSIPFSNTHY antigen name:Sperm surface protein Sp17 host organism:Papio

    Publication: 9022615;

  12. Autoimmunogenicity of the human sperm protein Sp17 in vasectomized men and identification of linear B cell epitopes.

    ID: 1755108

    Description: epitope description:GSKVEDRFYN antigen name:Sperm surface protein Sp17 host organism:Macaca

    Publication: 9022615;

  13. Autoimmunogenicity of the human sperm protein Sp17 in vasectomized men and identification of linear B cell epitopes.

    ID: 1755110

    Description: epitope description:RFYNNHAFEE antigen name:Sperm surface protein Sp17 host organism:Macaca

    Publication: 9022615;

  14. Autoimmunogenicity of the human sperm protein Sp17 in vasectomized men and identification of linear B cell epitopes.

    ID: 1755111

    Description: epitope description:NNHAFEEQEP antigen name:Sperm surface protein Sp17 host organism:Macaca

    Publication: 9022615;

  15. Autoimmunogenicity of the human sperm protein Sp17 in vasectomized men and identification of linear B cell epitopes.

    ID: 1755116

    Description: epitope description:KMKTNSLQNE antigen name:Sperm surface protein Sp17 host organism:Macaca

    Publication: 9022615;

  16. Autoimmunogenicity of the human sperm protein Sp17 in vasectomized men and identification of linear B cell epitopes.

    ID: 1755120

    Description: epitope description:FESLLEKREK antigen name:Sperm surface protein Sp17 host organism:Papio

    Publication: 9022615;

  17. Autoimmunogenicity of the human sperm protein Sp17 in vasectomized men and identification of linear B cell epitopes.

    ID: 1755125

    Description: epitope description:GSKVEDRFYN antigen name:Sperm surface protein Sp17 host organism:Papio

    Publication: 9022615;

  18. Autoimmunogenicity of the human sperm protein Sp17 in vasectomized men and identification of linear B cell epitopes.

    ID: 1755129

    Description: epitope description:EVAAVKIQAA antigen name:Sperm surface protein Sp17 host organism:Papio

    Publication: 9022615;

  19. Autoimmunogenicity of the human sperm protein Sp17 in vasectomized men and identification of linear B cell epitopes.

    ID: 1755130

    Description: epitope description:GHIAREEAKK antigen name:Sperm surface protein Sp17 host organism:Papio

    Publication: 9022615;

  20. Autoimmunogenicity of the human sperm protein Sp17 in vasectomized men and identification of linear B cell epitopes.

    ID: 1755131

    Description: epitope description:AREEAKKMKT antigen name:Sperm surface protein Sp17 host organism:Papio

    Publication: 9022615;

  21. Structure of the receptor-binding domain of human thrombopoietin determined by complexation with a neutralizing antibody fragment.

    ID: 1755178

    Description: epitope description:E78, T79, K80, A81, Q82, R119, G123, A124, L125, Q126, S127, L128, L129, G130, T131, Q132, L133, P134, P135, R136; antigen name:Th...

    Publication: 14769915;

  22. Inhibition of PDC-E2 human combinatorial autoantibodies by peptide mimotopes.

    ID: 1755281

    Description: epitope description:WMSYPDRTLRTS host organism:Homo sapiens antibody name:SP1, SP4

    Publication: 9115581;

  23. Inhibition of PDC-E2 human combinatorial autoantibodies by peptide mimotopes.

    ID: 1755284

    Description: epitope description:APKTYVSVSGMV host organism:Homo sapiens antibody name:SP1, SP4

    Publication: 9115581;

  24. Prediction of the immunodominant epitope of the pyruvate dehydrogenase complex E2 in primary biliary cirrhosis using phage display.

    ID: 1755304

    Description: epitope description:MHLTQSP host organism:Homo sapiens

    Publication: 10706737;

  25. Epitope mapping of bovine retinal S-antigen with monoclonal antibodies.

    ID: 1714463

    Description: epitope description:ARQNLKDAGE antigen name:S-arrestin host organism:Mus musculus BALB/c antibody name:PDS-1

    Publication: 2468451;

  26. Monoclonal antibody against human sperm-specific YLP12 peptide sequence involved in oocyte binding.

    ID: 1714486

    Description: epitope description:YLPVGGLRRIGG antigen name:Sperm surface protein Sp17 host organism:Mus musculus CD1 antibody name:YLP 12

    Publication: 11964208;

  27. Genetic bias in immune responses to a cassette shared by different microorganisms in patients with rheumatoid arthritis.

    ID: 1714495

    Description: epitope description:QKRAAQRAAGPSVAS antigen name:Envelope glycoprotein B host organism:Homo sapiens

    Publication: 9239413;

  28. The autoepitope of the 74-kD mitochondrial autoantigen of primary biliary cirrhosis corresponds to the functional site of dihydrolipoamide acetyltrans...

    ID: 1714548

    Description: epitope description:VPEGTRDVPL antigen name:Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial h...

    Publication: 2455013;

  29. Fine specificity and subclasses of IgG anti-actin autoantibodies differ in health and disease.

    ID: 1714568

    Description: epitope description:TIGNERFRCPET antigen name:Actin, alpha skeletal muscle host organism:Homo sapiens

    Publication: 12791319;

  30. Fine specificity and subclasses of IgG anti-actin autoantibodies differ in health and disease.

    ID: 1714571

    Description: epitope description:ETLFQPSFIGME antigen name:Actin, alpha skeletal muscle host organism:Homo sapiens

    Publication: 12791319;

  31. Fine specificity and subclasses of IgG anti-actin autoantibodies differ in health and disease.

    ID: 1714575

    Description: epitope description:YNSIMKCDIDIR antigen name:Actin, alpha skeletal muscle host organism:Homo sapiens

    Publication: 12791319;

  32. Fine specificity and subclasses of IgG anti-actin autoantibodies differ in health and disease.

    ID: 1714586

    Description: epitope description:IADRMQKEITAL antigen name:Actin, alpha skeletal muscle host organism:Homo sapiens

    Publication: 12791319;

  33. Fine specificity and subclasses of IgG anti-actin autoantibodies differ in health and disease.

    ID: 1714595

    Description: epitope description:VWIGGSILASLS antigen name:Actin, alpha skeletal muscle host organism:Homo sapiens

    Publication: 12791319;

  34. Fine specificity and subclasses of IgG anti-actin autoantibodies differ in health and disease.

    ID: 1714596

    Description: epitope description:LSTFQQMWITKQ antigen name:Actin, alpha skeletal muscle host organism:Homo sapiens

    Publication: 12791319;

  35. Fine specificity and subclasses of IgG anti-actin autoantibodies differ in health and disease.

    ID: 1714603

    Description: epitope description:EAGPSIVHRKCF antigen name:Actin, alpha skeletal muscle host organism:Homo sapiens

    Publication: 12791319;

  36. Fine specificity and subclasses of IgG anti-actin autoantibodies differ in health and disease.

    ID: 1714604

    Description: epitope description:EAGPSIVHRKCF antigen name:Actin, alpha skeletal muscle host organism:Homo sapiens

    Publication: 12791319;

  37. Identification of and human serum reactogenicity to neutralizing epitopes within the central unglycosylated region of the respiratory syncytial virus ...

    ID: 1714610

    Description: epitope description:RLKNPPKKPKDDYHFEVFNFVP antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:K6

    Publication: 20164253;

  38. Identification of and human serum reactogenicity to neutralizing epitopes within the central unglycosylated region of the respiratory syncytial virus ...

    ID: 1714614

    Description: epitope description:RQNKPPSKPNNDFHFEVFNFVP antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:K6

    Publication: 20164253;

  39. Identification of and human serum reactogenicity to neutralizing epitopes within the central unglycosylated region of the respiratory syncytial virus ...

    ID: 1714616

    Description: epitope description:RLKNPPKKPKDDYHFEVFNFVP antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:K6

    Publication: 20164253;

  40. Identification of and human serum reactogenicity to neutralizing epitopes within the central unglycosylated region of the respiratory syncytial virus ...

    ID: 1714620

    Description: epitope description:DFHFEVFNFVP antigen name:Major surface glycoprotein G host organism:Mus musculus BALB/c antibody name:K6

    Publication: 20164253;

  41. Cross-reactivity of antibodies against synthetic peptides.

    ID: 1714623

    Description: epitope description:KRSRHF antigen name:Mus musculus polyomavirus 1 protein host organism:Oryctolagus cuniculus

    Publication: 6294132;

  42. Studies of the antigenic structure of two cross-reacting proteins, pertussis and cholera toxins, using synthetic peptides.

    ID: 1714636

    Description: epitope description:EAERAGRGTG antigen name:Pertussis toxin subunit 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2927400;

  43. Studies of the antigenic structure of two cross-reacting proteins, pertussis and cholera toxins, using synthetic peptides.

    ID: 1714637

    Description: epitope description:EAERAGRGTG antigen name:Pertussis toxin subunit 1 host organism:Oryctolagus cuniculus

    Publication: 2927400;

  44. Studies of the antigenic structure of two cross-reacting proteins, pertussis and cholera toxins, using synthetic peptides.

    ID: 1714638

    Description: epitope description:EAERAGRGTG antigen name:Pertussis toxin subunit 1 host organism:Capra hircus

    Publication: 2927400;

  45. Studies of the antigenic structure of two cross-reacting proteins, pertussis and cholera toxins, using synthetic peptides.

    ID: 1714640

    Description: epitope description:YVDTYGDNAG antigen name:Pertussis toxin subunit 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2927400;

  46. Studies of the antigenic structure of two cross-reacting proteins, pertussis and cholera toxins, using synthetic peptides.

    ID: 1714644

    Description: epitope description:YVDTYGDNAG antigen name:Pertussis toxin subunit 1 host organism:Ovis aries

    Publication: 2927400;

  47. Studies of the antigenic structure of two cross-reacting proteins, pertussis and cholera toxins, using synthetic peptides.

    ID: 1714649

    Description: epitope description:YRYDSRPPEDV antigen name:Pertussis toxin subunit 1 host organism:Ovis aries

    Publication: 2927400;

  48. Rapid induction of autoantibodies by endogenous ovarian antigens and activated T cells: implication in autoimmune disease pathogenesis and B cell tole...

    ID: 1714651

    Description: epitope description:QFQIHGPR antigen name:Zona pellucida sperm-binding protein 3 host organism:Mus musculus (C57BL/6 X A/J)

    Publication: 8617983;

  49. Identification of antigenic epitopes of 1D antigen recognized by antibodies in the serum of patients with thyroid-associated ophthalmopathy.

    ID: 1714652

    Description: epitope description:RGRDASKKALGPRRNSDLGKEPKRGGLKKSFSRDRDE antigen name:Leiomodin-1 host organism:Homo sapiens

    Publication: 7586727;

  50. A 40-kilodalton cell wall protein-coding sequence upstream of the sr gene of Streptococcus mutans OMZ175 (serotype f).

    ID: 1714655

    Description: epitope description:SNPQVNVETDSSEKDE antigen name:UniProt:I6SU99 host organism:Oryctolagus cuniculus

    Publication: 2019433;

  51. A 40-kilodalton cell wall protein-coding sequence upstream of the sr gene of Streptococcus mutans OMZ175 (serotype f).

    ID: 1714659

    Description: epitope description:SNPQVNVETDSSEKDE antigen name:UniProt:I6SU99 host organism:Oryctolagus cuniculus

    Publication: 2019433;

  52. Novel monoclonal antibodies against Menangle virus nucleocapsid protein.

    ID: 1714795

    Description: epitope description:PPIPQMPQNIDWEVRLAEIERRNQQMAARDR antigen name:Menangle rubulavirus protein host organism:Mus musculus BALB/c antibody name:10G8

    Publication: 19898771;

  53. Monoclonal antibodies to the human TSH receptor: epitope mapping and binding to the native receptor on the basolateral plasma membrane of thyroid foll...

    ID: 1714810

    Description: epitope description:SDEFNPCEDIMGYK antigen name:Thyrotropin receptor host organism:Mus musculus C57BL/6 antibody name:A7

    Publication: 9156519;

  54. A protective immune response against lethal, dermonecrotic and hemorrhagic effects of Loxosceles intermedia venom elicited by a 27-residue peptide.

    ID: 1714821

    Description: epitope description:NLGANSIETDVSFDDNANPEYTYHGIP antigen name:Phospholipase D LiSicTox-alphaIA1bii host organism:Oryctolagus cuniculus New Zealand Whit...

    Publication: 19818803;

  55. A protective immune response against lethal, dermonecrotic and hemorrhagic effects of Loxosceles intermedia venom elicited by a 27-residue peptide.

    ID: 1714825

    Description: epitope description:NLGANSIETDVSFDDNANPEYTYHGIP antigen name:Phospholipase D LiSicTox-alphaIA1bii host organism:Oryctolagus cuniculus New Zealand Whit...

    Publication: 19818803;

  56. Antibodies against homologous microbial caseinolytic proteases P characterise primary biliary cirrhosis.

    ID: 1714840

    Description: epitope description:RIEKDTDRDNFMSAEEAQ antigen name:Other Haemophilus influenzae protein host organism:Homo sapiens

    Publication: 11804659;

  57. Immunogenicity and contraceptive potential of a human zona pellucida 3 peptide vaccine.

    ID: 1714852

    Description: epitope description:QPHVMS antigen name:Zona pellucida sperm-binding protein 3 host organism:Macaca fascicularis

    Publication: 9047023;

  58. Part II: influence of dimerization of a modified GnRH-I peptide sequence on a male antifertility vaccine.

    ID: 1714862

    Description: epitope description:HWSYGLRPG antigen name:Progonadoliberin-1 host organism:Rattus norvegicus Sprague-Dawley

    Publication: 12607773;

  59. Primary biliary cirrhosis is characterized by IgG3 antibodies cross-reactive with the major mitochondrial autoepitope and its Lactobacillus mimic.

    ID: 1714918

    Description: epitope description:RDSEGDLVAEKLGPI antigen name:Beta-galactosidase host organism:Homo sapiens

    Publication: 16025495;

  60. Primary biliary cirrhosis is characterized by IgG3 antibodies cross-reactive with the major mitochondrial autoepitope and its Lactobacillus mimic.

    ID: 1714922

    Description: epitope description:RDSEGDLVAEKLGPI antigen name:Beta-galactosidase host organism:Homo sapiens

    Publication: 16025495;

  61. Primary biliary cirrhosis is characterized by IgG3 antibodies cross-reactive with the major mitochondrial autoepitope and its Lactobacillus mimic.

    ID: 1714923

    Description: epitope description:RDSEGDLVAEKLGPI antigen name:Beta-galactosidase host organism:Homo sapiens

    Publication: 16025495;

  62. Crystal structures of the pro-inflammatory cytokine interleukin-23 and its complex with a high-affinity neutralizing antibody.

    ID: 1714925

    Description: epitope description:E101, G105, S106, D107, T110, G111, E112, P113, S114, H125, P152, S153, Q154, P155, W156, R158, L159 antigen name:Interleukin-23 s...

    Publication: 18708069;

  63. Primary biliary cirrhosis is characterized by IgG3 antibodies cross-reactive with the major mitochondrial autoepitope and its Lactobacillus mimic.

    ID: 1714936

    Description: epitope description:KVAAEQSLITVEGDK antigen name:Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex host organi...

    Publication: 16025495;

  64. Primary biliary cirrhosis is characterized by IgG3 antibodies cross-reactive with the major mitochondrial autoepitope and its Lactobacillus mimic.

    ID: 1714937

    Description: epitope description:RDSEGDLVAEKLGPI antigen name:Beta-galactosidase host organism:Homo sapiens

    Publication: 16025495;

  65. Shift in epitope dominance of IgM and IgG responses to Plasmodium falciparum MSP1 block 4.

    ID: 1714947

    Description: epitope description:NENIKELLDKINEIKNPPPANSGNTPNTLLDKNKKIE antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 20070906;

  66. Shift in epitope dominance of IgM and IgG responses to Plasmodium falciparum MSP1 block 4.

    ID: 1714949

    Description: epitope description:NENIKKLLEDIDKIKTDAENPTTGSKPNPLPENKKKEVEG antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 20070906;

  67. Shift in epitope dominance of IgM and IgG responses to Plasmodium falciparum MSP1 block 4.

    ID: 1714954

    Description: epitope description:NENIKKLLDKINEIKNPPPANSGNTPNPLPENKKKEVEG antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 20070906;

  68. Shift in epitope dominance of IgM and IgG responses to Plasmodium falciparum MSP1 block 4.

    ID: 1714957

    Description: epitope description:NENIKKLLDKINEIKNPPPANSGNTPNPLPENKKKEVEG antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 20070906;

  69. Shift in epitope dominance of IgM and IgG responses to Plasmodium falciparum MSP1 block 4.

    ID: 1714960

    Description: epitope description:NENIKKLLEDIDKIKTDAEKPTTGSKPNTLLDKNKKIE antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 20070906;

  70. Shift in epitope dominance of IgM and IgG responses to Plasmodium falciparum MSP1 block 4.

    ID: 1714962

    Description: epitope description:NENIKKLLEDIDKIKTDAEKPTTGSKPNTLLDKNKKIE antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 20070906;

  71. Shift in epitope dominance of IgM and IgG responses to Plasmodium falciparum MSP1 block 4.

    ID: 1714963

    Description: epitope description:NENIKKLLEDIDKIKTDAEKPTTGSKPNTLLDKNKKIE antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 20070906;

  72. Antigenic domains analysis of classical swine fever virus E2 glycoprotein by mutagenesis and conformation-dependent monoclonal antibodies.

    ID: 1714972

    Description: epitope description:C5, C49, L83, L84, F85, D86 antigen name:Genome polyprotein host organism:Mus musculus antibody name:C2, L7, L150

    Publication: 20132851;

  73. Delineation of a conserved B cell epitope on bonnet monkey (Macaca radiata) and human zona pellucida glycoprotein-B by monoclonal antibodies demonstra...

    ID: 1715515

    Description: epitope description:DWC antigen name:Glycoprotein zona pellucida-1 host organism:Mus musculus BALB/c antibody name:MA-813

    Publication: 10611069;

  74. Delineation of a conserved B cell epitope on bonnet monkey (Macaca radiata) and human zona pellucida glycoprotein-B by monoclonal antibodies demonstra...

    ID: 1715516

    Description: epitope description:DWC antigen name:Glycoprotein zona pellucida-1 host organism:Mus musculus BALB/c antibody name:MA-825

    Publication: 10611069;

  75. Structure and kinetics of a transient antibody binding intermediate reveal a kinetic discrimination mechanism in antigen recognition.

    ID: 1716456

    Description: epitope description:furazolidone host organism:Mus musculus C57BL/6 antibody name:SPE7

    Publication: 16129832;

  76. Structure and kinetics of a transient antibody binding intermediate reveal a kinetic discrimination mechanism in antigen recognition.

    ID: 1716457

    Description: epitope description:furazolidone host organism:Mus musculus C57BL/6 antibody name:SPE7

    Publication: 16129832;

  77. Analysis of the uveitogenic determinant in repeat structure of retinal interphotoreceptor retinoid-binding protein (IRBP).

    ID: 1716498

    Description: epitope description:GSSWEGVGVVPDV antigen name:Retinol-binding protein 3 host organism:Rattus norvegicus Lewis antibody name:Rat sera

    Publication: 8050169;

  78. Analysis of the uveitogenic determinant in repeat structure of retinal interphotoreceptor retinoid-binding protein (IRBP).

    ID: 1716499

    Description: epitope description:WEGVGVVPDVAVP antigen name:Retinol-binding protein 3 host organism:Rattus norvegicus Lewis antibody name:Rat sera

    Publication: 8050169;

  79. Analysis of the uveitogenic determinant in repeat structure of retinal interphotoreceptor retinoid-binding protein (IRBP).

    ID: 1716501

    Description: epitope description:GECWLGGGVVPDA antigen name:Retinol-binding protein 3 host organism:Rattus norvegicus Lewis antibody name:Rat sera

    Publication: 8050169;

  80. Analysis of the uveitogenic determinant in repeat structure of retinal interphotoreceptor retinoid-binding protein (IRBP).

    ID: 1716506

    Description: epitope description:WEGVGVVPDV antigen name:Retinol-binding protein 3 host organism:Rattus norvegicus Lewis antibody name:Rat sera

    Publication: 8050169;

  81. Endocytotic segregation of gliadin peptide 31-49 in enterocytes.

    ID: 1716515

    Description: epitope description:GQQQPFPPQ antigen name:Tri a 21 host organism:Mus musculus BALB/c antibody name:WB8

    Publication: 19654123;

  82. Screening and identification of dominant functional fragments of human epididymal protease inhibitor.

    ID: 1716536

    Description: epitope description:TCSMFVYGGC antigen name:Eppin host organism:Mus musculus BALB/c

    Publication: 20005859;

  83. Screening and identification of dominant functional fragments of human epididymal protease inhibitor.

    ID: 1716540

    Description: epitope description:FVYGGCQGNN antigen name:Eppin host organism:Mus musculus BALB/c

    Publication: 20005859;

  84. Screening and identification of dominant functional fragments of human epididymal protease inhibitor.

    ID: 1716544

    Description: epitope description:NNNNFQSKAN antigen name:Eppin host organism:Mus musculus BALB/c

    Publication: 20005859;

  85. Endocytotic segregation of gliadin peptide 31-49 in enterocytes.

    ID: 1716554

    Description: epitope description:QQQPFP antigen name:Tri a 21 host organism:Mus musculus BALB/c antibody name:R5

    Publication: 19654123;

  86. A new panel of NS1 antibodies for easy detection and titration of influenza A virus.

    ID: 1716556

    Description: epitope description:SLRGRGNTLGLD antigen name:Non-structural protein 1 host organism:Mus musculus BALB/c antibody name:6A4, 2H6

    Publication: 20087939;

  87. A new panel of NS1 antibodies for easy detection and titration of influenza A virus.

    ID: 1716558

    Description: epitope description:SLRGRGNTLGLD antigen name:Non-structural protein 1 host organism:Mus musculus BALB/c antibody name:6A4, 2H6

    Publication: 20087939;

  88. A new panel of NS1 antibodies for easy detection and titration of influenza A virus.

    ID: 1716562

    Description: epitope description:RLPLPPNQKR antigen name:Non-structural protein 1 host organism:Mus musculus BALB/c antibody name:1G1

    Publication: 20087939;

  89. A new panel of NS1 antibodies for easy detection and titration of influenza A virus.

    ID: 1716563

    Description: epitope description:RLPLPPNQKR antigen name:Non-structural protein 1 host organism:Mus musculus BALB/c antibody name:1G1

    Publication: 20087939;

  90. Characterization and epitope mapping of monoclonal antibodies recognizing N-terminus of Rep of porcine circovirus type 2.

    ID: 1716588

    Description: epitope description:LFDYFIVG antigen name:Replication-associated protein host organism:Mus musculus BALB/c antibody name:1C1

    Publication: 20152863;

  91. Characterization and epitope mapping of monoclonal antibodies recognizing N-terminus of Rep of porcine circovirus type 2.

    ID: 1716602

    Description: epitope description:KEGNLLIE antigen name:Replication-associated protein host organism:Mus musculus BALB/c antibody name:3D10

    Publication: 20152863;

  92. Predominant occupation of the class I MHC molecule H-2Kwm7 with a single self-peptide suggests a mechanism for its diabetes-protective effect.

    ID: 1716642

    Description: epitope description:VNIPFVRL antigen name:NFX1-type zinc finger-containing protein 1 host organism:Mus musculus C57BL/10 antibody name:HD42

    Publication: 20093428;

  93. Germline humanization of a murine Abeta antibody and crystal structure of the humanized recombinant Fab fragment.

    ID: 1716643

    Description: epitope description:EFRH antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:WO-2

    Publication: 20014445;

  94. Antiserum to an inhibin alpha-chain peptide neutralizes inhibin bioactivity and increases ovulation rate in sheep.

    ID: 1716663

    Description: epitope description:MPLLWLRGFLLASCWIIVRSSPTPG antigen name:Inhibin beta A chain host organism:Ovis aries

    Publication: 1707868;

  95. Cytochrome P4502D6(193-212): a new immunodominant epitope and target of virus/self cross-reactivity in liver kidney microsomal autoantibody type 1-pos...

    ID: 1716742

    Description: epitope description:LARYGPAWREQRRFSVSTLR antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 12538711;

  96. Cytochrome P4502D6(193-212): a new immunodominant epitope and target of virus/self cross-reactivity in liver kidney microsomal autoantibody type 1-pos...

    ID: 1716748

    Description: epitope description:LAQEGLKEESGFLREVLNAV antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 12538711;

  97. Cytochrome P4502D6(193-212): a new immunodominant epitope and target of virus/self cross-reactivity in liver kidney microsomal autoantibody type 1-pos...

    ID: 1716749

    Description: epitope description:VLNAVPVLLHIPALAGKVLR antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 12538711;

  98. Cytochrome P4502D6(193-212): a new immunodominant epitope and target of virus/self cross-reactivity in liver kidney microsomal autoantibody type 1-pos...

    ID: 1716755

    Description: epitope description:TLAWGLLLMILHPDVQRRVQ antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 12538711;

  99. Cytochrome P4502D6(193-212): a new immunodominant epitope and target of virus/self cross-reactivity in liver kidney microsomal autoantibody type 1-pos...

    ID: 1716759

    Description: epitope description:GVTHMTSRDIEVQGFRIPKG antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 12538711;

  100. Cytochrome P4502D6(193-212): a new immunodominant epitope and target of virus/self cross-reactivity in liver kidney microsomal autoantibody type 1-pos...

    ID: 1716761

    Description: epitope description:LKDEAVWEKPFRFHPEHFLD antigen name:Cytochrome P450 2D6 host organism:Homo sapiens

    Publication: 12538711;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston