Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Delineation of type-specific regions on the envelope glycoproteins of human T cell leukemia viruses.

    ID: 1486997

    Description: epitope description:IVCIDRASLST antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1717557;

  2. Delineation of type-specific regions on the envelope glycoproteins of human T cell leukemia viruses.

    ID: 1486999

    Description: epitope description:FNWTHCFDPQI antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1717557;

  3. Delineation of type-specific regions on the envelope glycoproteins of human T cell leukemia viruses.

    ID: 1487000

    Description: epitope description:SPCHNSLILP antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1717557;

  4. Delineation of type-specific regions on the envelope glycoproteins of human T cell leukemia viruses.

    ID: 1487002

    Description: epitope description:NTEPSQLPPTA antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1717557;

  5. Delineation of type-specific regions on the envelope glycoproteins of human T cell leukemia viruses.

    ID: 1487013

    Description: epitope description:DAPGYDPIWFLNTEPSQLPPTAPPLLPHSNLDHILE antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1717557;

  6. Mapping of linear epitopes on the capsid proteins of swine vesicular disease virus using monoclonal antibodies.

    ID: 1487025

    Description: epitope description:TPEMDIPGQV antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1H10, 4B1

    Publication: 12029154;

  7. Mapping of linear epitopes on the capsid proteins of swine vesicular disease virus using monoclonal antibodies.

    ID: 1487026

    Description: epitope description:TPEMDIPGQV antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1H10, 4B1

    Publication: 12029154;

  8. Mapping of linear epitopes on the capsid proteins of swine vesicular disease virus using monoclonal antibodies.

    ID: 1487027

    Description: epitope description:TPEMDIPGQV antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1H10, 4B1

    Publication: 12029154;

  9. Sensitive detection of cereal fractions that are toxic to celiac disease patients by using monoclonal antibodies to a main immunogenic wheat peptide.

    ID: 1487033

    Description: epitope description:LQLQPFPQPQLPYPQPQLPYPQPQLPYPQPQPF antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Mus musc...

    Publication: 18258632;

  10. Mapping of linear epitopes on the capsid proteins of swine vesicular disease virus using monoclonal antibodies.

    ID: 1487057

    Description: epitope description:C181, N182, A183, S184, K185, F186, H187, Q188, G189, C190, L191, L192, V193, V194, C195, V196, P197, E198, A199, E200, M201, G20...

    Publication: 12029154;

  11. Mapping of linear epitopes on the capsid proteins of swine vesicular disease virus using monoclonal antibodies.

    ID: 1487058

    Description: epitope description:NQFLTSDDFQSPSAMPQFDVTPEMDIPGQV antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1H2, 1H7, 3D7, 5D6,...

    Publication: 12029154;

  12. Mapping of linear epitopes on the capsid proteins of swine vesicular disease virus using monoclonal antibodies.

    ID: 1487065

    Description: epitope description:PADAQSDCKILCFVSACNDF antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1H2, 1H7, 3D7, 5D6, 3C1, 4A9

    Publication: 12029154;

  13. Novel sequences and epitopes of diagnostic value derived from the Anisakis simplex Ani s 7 major allergen.

    ID: 1487303

    Description: epitope description:MCQCVQKYGTEFCKKRLA antigen name:Other Anisakis simplex (herring worm) protein host organism:Mus musculus antibody name:UA3

    Publication: 18186812;

  14. T-helper and humoral responses to Puumala hantavirus nucleocapsid protein: identification of T-helper epitopes in a mouse model.

    ID: 1487309

    Description: epitope description:DIQEEITRHE antigen name:Puumala orthohantavirus protein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 11125166;

  15. T-helper and humoral responses to Puumala hantavirus nucleocapsid protein: identification of T-helper epitopes in a mouse model.

    ID: 1487317

    Description: epitope description:PTGIEPDDHL antigen name:Puumala orthohantavirus protein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 11125166;

  16. T-helper and humoral responses to Puumala hantavirus nucleocapsid protein: identification of T-helper epitopes in a mouse model.

    ID: 1487338

    Description: epitope description:KNTLQARQQT antigen name:Puumala orthohantavirus protein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 11125166;

  17. T-helper and humoral responses to Puumala hantavirus nucleocapsid protein: identification of T-helper epitopes in a mouse model.

    ID: 1487340

    Description: epitope description:ADAVSRKKMD antigen name:Puumala orthohantavirus protein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 11125166;

  18. T-helper and humoral responses to Puumala hantavirus nucleocapsid protein: identification of T-helper epitopes in a mouse model.

    ID: 1487344

    Description: epitope description:TADWYTIGVY antigen name:Puumala orthohantavirus protein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 11125166;

  19. T-helper and humoral responses to Puumala hantavirus nucleocapsid protein: identification of T-helper epitopes in a mouse model.

    ID: 1487345

    Description: epitope description:TIGVYVIGFT antigen name:Puumala orthohantavirus protein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 11125166;

  20. T-helper and humoral responses to Puumala hantavirus nucleocapsid protein: identification of T-helper epitopes in a mouse model.

    ID: 1487347

    Description: epitope description:IPIILKALYM antigen name:Puumala orthohantavirus protein host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 11125166;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston