Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. HCV core immunodominant region analysis using mouse monoclonal antibodies and human sera: characterization of major epitopes useful for antigen detect...

    ID: 1279655

    Description: epitope description:ATRKTSER antigen name:Genome polyprotein host organism:Homo sapiens antibody name:human serum

    Publication: 9829633;

  2. HCV core immunodominant region analysis using mouse monoclonal antibodies and human sera: characterization of major epitopes useful for antigen detect...

    ID: 1279656

    Description: epitope description:TRKTSERS antigen name:Genome polyprotein host organism:Homo sapiens antibody name:human serum

    Publication: 9829633;

  3. HCV core immunodominant region analysis using mouse monoclonal antibodies and human sera: characterization of major epitopes useful for antigen detect...

    ID: 1279657

    Description: epitope description:RKTSERSQ antigen name:Genome polyprotein host organism:Homo sapiens antibody name:human serum

    Publication: 9829633;

  4. T lymphocyte responses in CVB3-induced murine myocarditis.

    ID: 1314853

    Description: epitope description:GPVEDAITAAIGRV antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:Anti-H3 Polyclonal

    Publication: 7685923;

  5. T lymphocyte responses in CVB3-induced murine myocarditis.

    ID: 1314857

    Description: epitope description:RHVNAGSTGPIKSTI antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 7685923;

  6. T lymphocyte responses in CVB3-induced murine myocarditis.

    ID: 1314866

    Description: epitope description:ESTIENFLCRSAC antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 7685923;

  7. T lymphocyte responses in CVB3-induced murine myocarditis.

    ID: 1314871

    Description: epitope description:YVRFDLELTFVITST antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 7685923;

  8. T lymphocyte responses in CVB3-induced murine myocarditis.

    ID: 1314872

    Description: epitope description:VITSTQQPSTTQNQD antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 7685923;

  9. T lymphocyte responses in CVB3-induced murine myocarditis.

    ID: 1314875

    Description: epitope description:PVPDKVDSYVWQTST antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 7685923;

  10. T lymphocyte responses in CVB3-induced murine myocarditis.

    ID: 1314876

    Description: epitope description:WQTSTNPSVFWTEGN antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 7685923;

  11. T lymphocyte responses in CVB3-induced murine myocarditis.

    ID: 1314878

    Description: epitope description:SIPFLSIGNAYSNFY antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 7685923;

  12. T lymphocyte responses in CVB3-induced murine myocarditis.

    ID: 1314882

    Description: epitope description:VNRHSATSADWQNC antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 7685923;

  13. T lymphocyte responses in CVB3-induced murine myocarditis.

    ID: 1314883

    Description: epitope description:RHVKNYHSRSESTIE antigen name:Genome polyprotein host organism:Mus musculus antibody name:49.8.9, 36.2.2, and 54.2.8

    Publication: 7685923;

  14. Structural features of envelope proteins on hepatitis C virus-like particles as determined by anti-envelope monoclonal antibodies and CD81 binding.

    ID: 1314999

    Description: epitope description:YEVRNVSGIYHVTNDCSNS antigen name:Genome polyprotein host organism:Mus musculus antibody name:159

    Publication: 12093180;

  15. Structural features of envelope proteins on hepatitis C virus-like particles as determined by anti-envelope monoclonal antibodies and CD81 binding.

    ID: 1315003

    Description: epitope description:QLINTNGSWHVN antigen name:Genome polyprotein host organism:Mus musculus antibody name:AP33

    Publication: 12093180;

  16. Structural features of envelope proteins on hepatitis C virus-like particles as determined by anti-envelope monoclonal antibodies and CD81 binding.

    ID: 1315008

    Description: epitope description:APTYSWGA antigen name:Genome polyprotein host organism:Mus musculus antibody name:9/75

    Publication: 12093180;

  17. Structural features of envelope proteins on hepatitis C virus-like particles as determined by anti-envelope monoclonal antibodies and CD81 binding.

    ID: 1315090

    Description: epitope description:GWLAGLFYHHK antigen name:Genome polyprotein host organism:Mus musculus antibody name:7/16b

    Publication: 12093180;

  18. Structural features of envelope proteins on hepatitis C virus-like particles as determined by anti-envelope monoclonal antibodies and CD81 binding.

    ID: 1315091

    Description: epitope description:DQRPYCWHYPP antigen name:Genome polyprotein host organism:Mus musculus antibody name:6/41a

    Publication: 12093180;

  19. Monoclonal antibody AP33 defines a broadly neutralizing epitope on the hepatitis C virus E2 envelope glycoprotein.

    ID: 1315153

    Description: epitope description:QLINTNGSWHIN antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:AP33

    Publication: 16103160;

  20. Monoclonal antibody AP33 defines a broadly neutralizing epitope on the hepatitis C virus E2 envelope glycoprotein.

    ID: 1315154

    Description: epitope description:CNWTRGER antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:ALP98

    Publication: 16103160;

  21. Antibodies directed to envelope proteins of hepatitis C virus outside of hypervariable region 1.

    ID: 1315155

    Description: epitope description:GCSFSIFLLALLSCLTIPAS antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 9568031;

  22. Monoclonal antibody AP33 defines a broadly neutralizing epitope on the hepatitis C virus E2 envelope glycoprotein.

    ID: 1315170

    Description: epitope description:ETHVTGGNAGRTTAGLVG antigen name:Genome polyprotein host organism:Oryctolagus cuniculus antibody name:R645, R646, R1020

    Publication: 16103160;

  23. Monoclonal antibody AP33 defines a broadly neutralizing epitope on the hepatitis C virus E2 envelope glycoprotein.

    ID: 1315175

    Description: epitope description:NTGWLAGLFYQHKFNSSG antigen name:Genome polyprotein host organism:Oryctolagus cuniculus antibody name:R645, R646, R1020

    Publication: 16103160;

  24. Antibodies directed to envelope proteins of hepatitis C virus outside of hypervariable region 1.

    ID: 1315185

    Description: epitope description:SIVYETADMIMHTPGCVPCV antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 9568031;

  25. Antibodies directed to envelope proteins of hepatitis C virus outside of hypervariable region 1.

    ID: 1315186

    Description: epitope description:MHTPGCVPCVREDNSSRCWV antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 9568031;

  26. Antibodies directed to envelope proteins of hepatitis C virus outside of hypervariable region 1.

    ID: 1315200

    Description: epitope description:CNIGGLGNNTLICPTDCFRK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 9568031;

  27. Antibodies directed to envelope proteins of hepatitis C virus outside of hypervariable region 1.

    ID: 1315205

    Description: epitope description:SSGCPERMASCRPIDRFAQG antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 9568031;

  28. Antibodies directed to envelope proteins of hepatitis C virus outside of hypervariable region 1.

    ID: 1315210

    Description: epitope description:ASEVCGPVYCFTPSPVVVGT antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 9568031;

  29. Antibodies directed to envelope proteins of hepatitis C virus outside of hypervariable region 1.

    ID: 1315215

    Description: epitope description:HSEATYTKCGSGPWLTPRCI antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 9568031;

  30. Antibodies directed to envelope proteins of hepatitis C virus outside of hypervariable region 1.

    ID: 1315216

    Description: epitope description:SGPWLTPRCIVDYPYRLWHY antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 9568031;

  31. Antibodies directed to envelope proteins of hepatitis C virus outside of hypervariable region 1.

    ID: 1315218

    Description: epitope description:PCTVNFTIFKVRMYVGGIEH antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 9568031;

  32. Antibodies directed to envelope proteins of hepatitis C virus outside of hypervariable region 1.

    ID: 1315229

    Description: epitope description:QKIQLINTNGSWHINRTALN antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 9568031;

  33. Antibodies directed to envelope proteins of hepatitis C virus outside of hypervariable region 1.

    ID: 1315244

    Description: epitope description:LICPTDCFRKHSEATYTKCG antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 9568031;

  34. Antibodies directed to envelope proteins of hepatitis C virus outside of hypervariable region 1.

    ID: 1315246

    Description: epitope description:SGPWLTPRCIVDYPYRLWHY antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 9568031;

  35. Synthetic peptide immunogens elicit polyclonal and monoclonal antibodies specific for linear epitopes in the D motifs of Staphylococcus aureus fibrone...

    ID: 1315261

    Description: epitope description:QGGNIVDIDFDSVP antigen name:Fibronectin-binding protein A host organism:Oryctolagus cuniculus New Zealand White

    Publication: 10678920;

  36. An antibody raised against a conserved sequence of the prion protein recognizes pathological isoforms in human and animal prion diseases, including Cr...

    ID: 1315548

    Description: epitope description:SQWNKPSKPKTN antigen name:Major prion protein host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-PrP 95-108

    Publication: 9626045;

  37. An antibody raised against a conserved sequence of the prion protein recognizes pathological isoforms in human and animal prion diseases, including Cr...

    ID: 1315561

    Description: epitope description:SQWNKPSKPKTN antigen name:Major prion protein host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-PrP 95-108

    Publication: 9626045;

  38. Characterization of lethal factor binding and cell receptor binding domains of protective antigen of Bacillus anthracis using monoclonal antibodies.

    ID: 1315569

    Description: epitope description:IKLNAKMNILIRDKRFHYDRN antigen name:Protective antigen host organism:Mus musculus BALB/c antibody name:2D3PA, 2D5PA...

    Publication: 8868446;

  39. T-Cell-dependent antibody response to the dominant epitope of streptococcal polysaccharide, N-acetyl-glucosamine, is cross-reactive with cardiac myosi...

    ID: 1315570

    Description: epitope description:N-acetyl-D-galactosamine antigen name:polysaccharide host organism:Mus musculus BALB/c antibody name:10D4-A9, 2D6-B1, 16B2-A1, 14G...

    Publication: 10992488;

  40. Characterization of lethal factor binding and cell receptor binding domains of protective antigen of Bacillus anthracis using monoclonal antibodies.

    ID: 1315605

    Description: epitope description:DGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSENGDTSTNGI antigen name:Protective antigen host organism:Mus musculus BALB/c antibody nam...

    Publication: 8868446;

  41. Modification of blood cell PrP epitope exposure during prion disease.

    ID: 1315607

    Description: epitope description:PGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGG antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:T1...

    Publication: 15885031;

  42. Modification of blood cell PrP epitope exposure during prion disease.

    ID: 1315610

    Description: epitope description:CITQYQRESQAYYQRG antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:V26

    Publication: 15885031;

  43. Identification of antigenic sites on three hepatitis C virus proteins using phage-displayed peptide libraries.

    ID: 1315621

    Description: epitope description:PPVLYLPWLPWGPSV host organism:Homo sapiens

    Publication: 9746064;

  44. Synthetic peptide immunogens elicit polyclonal and monoclonal antibodies specific for linear epitopes in the D motifs of Staphylococcus aureus fibrone...

    ID: 1315686

    Description: epitope description:YQFGGHNSVD antigen name:Fibronectin-binding protein A host organism:Oryctolagus cuniculus New Zealand White

    Publication: 10678920;

  45. Synthetic peptide immunogens elicit polyclonal and monoclonal antibodies specific for linear epitopes in the D motifs of Staphylococcus aureus fibrone...

    ID: 1315687

    Description: epitope description:FGGHNSVDFE antigen name:Fibronectin-binding protein A host organism:Oryctolagus cuniculus New Zealand White

    Publication: 10678920;

  46. Identification of antigenic sites on three hepatitis C virus proteins using phage-displayed peptide libraries.

    ID: 1315706

    Description: epitope description:WSQMVPFDPLRLLDGS host organism:Homo sapiens

    Publication: 9746064;

  47. Identification of antigenic sites on three hepatitis C virus proteins using phage-displayed peptide libraries.

    ID: 1315710

    Description: epitope description:HSIRSTTRLHTTLSL host organism:Homo sapiens

    Publication: 9746064;

  48. Identification of antigenic sites on three hepatitis C virus proteins using phage-displayed peptide libraries.

    ID: 1315755

    Description: epitope description:SRKQKKIRLRSSNNT host organism:Homo sapiens

    Publication: 9746064;

  49. Identification of antigenic sites on three hepatitis C virus proteins using phage-displayed peptide libraries.

    ID: 1315758

    Description: epitope description:ADDTPYTLSFAPHRH host organism:Homo sapiens

    Publication: 9746064;

  50. Antigenic features of prion proteins of sheep and of other mammalian species.

    ID: 1315832

    Description: epitope description:RYPGQGSPGGNRYPPQG antigen name:Major prion protein host organism:Oryctolagus cuniculus Chinchilla antibody name:Ra anti 40-56

    Publication: 9328590;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston