Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 5 of 1,510,353 results for " "
  1. Continuous B-cell epitopes in Chlamydia trachomatis heat shock protein 60.

    ID: 1469550

    Description: epitope description:GAIIFQQVMSRS antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 7679373;
  2. Chlamydia trachomatis major outer membrane protein epitopes expressed as fusions with LamB in an attenuated aro A strain of Salmonella typhimurium; th...

    ID: 1469595

    Description: epitope description:SAETIFDVTTLDPLNPTIAGAGDV host organism:Mus musculus C3H/He antibody name:Mouse anti-B1+B2 sera

    Publication: 1720166;
  3. Identification and localization of a limited number of predominant conformation-independent antibody epitopes of Theiler's murine encephalomyelitus vi...

    ID: 1470406

    Description: epitope description:FYSTNPDTTVPIYGKTISTPSDYMCGEFSDLL antigen name:Cardiovirus B protein host organism:Mus musculus SJL antibody name:Mouse anti-TMEV a...

    Publication: 1371268;
  4. The amino terminus of human cytomegalovirus glycoprotein B contains epitopes that vary among strains.

    ID: 1470417

    Description: epitope description:ASTAAPPYTNEQAYQMLLAL antigen name:Envelope glycoprotein B host organism:Mus musculus BALB/c antibody name:CH405-1, CH421-5

    Publication: 1378884;
  5. Induction of a protective immunity against Schistosoma mansoni with ovalbumin-coupled Sm37-5 coadsorbed with granulocyte-macrophage colony stimulating...

    ID: 1470467

    Description: epitope description:SGPLKGILEYTEDEVVSSDFVG antigen name:Glyceraldehyde-3-phosphate dehydrogenase host organism:Mus musculus CBA/J antibody name:mouse ...

    Publication: 10078602;

Displaying 5 of 1,510,353 results for " "