The cysteine-rich amino terminus of the thyrotropin receptor is the immunodominant linear antibody epitope in mice immunized using naked deoxyribonucl...

ID: 1764146

Description: epitope description:FRVTCKDIQRIPSLPPSTQT antigen name:Thyrotropin receptor host organism:Mus musculus BALB/c

The cysteine-rich amino terminus of the thyrotropin receptor is the immunodominant linear antibody epitope in mice immunized using naked deoxyribonucl...

ID: 1764148

Description: epitope description:FRVTCKDIQRIPSLPPSTQT antigen name:Thyrotropin receptor host organism:Mus musculus BALB/c

The cysteine-rich amino terminus of the thyrotropin receptor is the immunodominant linear antibody epitope in mice immunized using naked deoxyribonucl...

ID: 1764151

Description: epitope description:PSTQTLKLIETHLRTIPSHA antigen name:Thyrotropin receptor host organism:Mus musculus BALB/c

The cysteine-rich amino terminus of the thyrotropin receptor is the immunodominant linear antibody epitope in mice immunized using naked deoxyribonucl...

ID: 1764152

Description: epitope description:IPSHAFSNLPNISRIYVSID antigen name:Thyrotropin receptor host organism:Mus musculus BALB/c

The cysteine-rich amino terminus of the thyrotropin receptor is the immunodominant linear antibody epitope in mice immunized using naked deoxyribonucl...

ID: 1764154

Description: epitope description:IPSHAFSNLPNISRIYVSID antigen name:Thyrotropin receptor host organism:Mus musculus BALB/c

The cysteine-rich amino terminus of the thyrotropin receptor is the immunodominant linear antibody epitope in mice immunized using naked deoxyribonucl...

ID: 1764156

Description: epitope description:YVSIDVTLQQLESHSFYNLS antigen name:Thyrotropin receptor host organism:Mus musculus BALB/c

The cysteine-rich amino terminus of the thyrotropin receptor is the immunodominant linear antibody epitope in mice immunized using naked deoxyribonucl...

ID: 1764158

Description: epitope description:FYNLSKVTHIEIRNTRNLTY antigen name:Thyrotropin receptor host organism:Mus musculus BALB/c

The cysteine-rich amino terminus of the thyrotropin receptor is the immunodominant linear antibody epitope in mice immunized using naked deoxyribonucl...

ID: 1764167

Description: epitope description:PDLTKVYSTDIFFILEITDN antigen name:Thyrotropin receptor host organism:Mus musculus BALB/c

The cysteine-rich amino terminus of the thyrotropin receptor is the immunodominant linear antibody epitope in mice immunized using naked deoxyribonucl...

ID: 1764170

Description: epitope description:EITDNPYMTSIPVNAFQGLC antigen name:Thyrotropin receptor host organism:Mus musculus BALB/c

Prediction of the immunodominant epitope of the pyruvate dehydrogenase complex E2 in primary biliary cirrhosis using phage display.

ID: 1755313

Description: epitope description:GWGQLFQ host organism:Homo sapiens

Prediction of the immunodominant epitope of the pyruvate dehydrogenase complex E2 in primary biliary cirrhosis using phage display.

ID: 1755314

Description: epitope description:HYHRPPE host organism:Homo sapiens

Prediction of the immunodominant epitope of the pyruvate dehydrogenase complex E2 in primary biliary cirrhosis using phage display.

ID: 1755321

Description: epitope description:SAPWPPT host organism:Homo sapiens

Prediction of the immunodominant epitope of the pyruvate dehydrogenase complex E2 in primary biliary cirrhosis using phage display.

ID: 1755326

Description: epitope description:AMDPPYS host organism:Homo sapiens

Prediction of the immunodominant epitope of the pyruvate dehydrogenase complex E2 in primary biliary cirrhosis using phage display.

ID: 1755328

Description: epitope description:FPKNSTV host organism:Homo sapiens

Prediction of the immunodominant epitope of the pyruvate dehydrogenase complex E2 in primary biliary cirrhosis using phage display.

ID: 1755341

Description: epitope description:MHSPSTQ host organism:Homo sapiens

Prediction of the immunodominant epitope of the pyruvate dehydrogenase complex E2 in primary biliary cirrhosis using phage display.

ID: 1755358

Description: epitope description:ESMPALS host organism:Homo sapiens

Prediction of the immunodominant epitope of the pyruvate dehydrogenase complex E2 in primary biliary cirrhosis using phage display.

ID: 1755360

Description: epitope description:KWSFTPP host organism:Homo sapiens

Prediction of the immunodominant epitope of the pyruvate dehydrogenase complex E2 in primary biliary cirrhosis using phage display.

ID: 1755364

Description: epitope description:LPYKLTQ host organism:Homo sapiens

Epitope recognition patterns of thyroid peroxidase autoantibodies in healthy individuals and patients with Hashimoto's thyroiditis*.

ID: 1760563

Description: epitope description:GLPRLETPADLSTAIASRS antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Oryctolagus cuniculus New Zealand White antibod...

Cicatricial pemphigoid: IgA and IgG autoantibodies target epitopes on both intra- and extracellular domains of bullous pemphigoid antigen 180.

ID: 1760573

Description: epitope description:ADFAGDLDYNELAVRVSESMQRQGLLQGMAYTVQGPPGQPGPQGPPGIS antigen name:Collagen alpha-1(XVII) chain host organism:Homo sapiens

Induction of autoimmune thyroiditis and hypothyroidism by immunization of immunoactive T cell epitope of thyroid peroxidase.

ID: 1760605

Description: epitope description:QGQLMNEELTERLFVLSNVG antigen name:Thyroid peroxidase host organism:Mus musculus C57BL/6

Immune recognition of hormonogenic sites of human thyroglobulin: studies of Graves' sera and a murine monoclonal antibody with thyroid hormone antibod...

ID: 1760628

Description: epitope description:EHSTDDYASFSR antigen name:Thyroglobulin host organism:Homo sapiens

Immune recognition of hormonogenic sites of human thyroglobulin: studies of Graves' sera and a murine monoclonal antibody with thyroid hormone antibod...

ID: 1760630

Description: epitope description:HAPENYGHGSLE antigen name:Thyroglobulin host organism:Homo sapiens

Unique autoantibody epitopes in an immunodominant region of thyroid peroxidase.

ID: 1760654

Description: epitope description:NEWREFCGLPRLETPADLSTAI antigen name:Thyroid peroxidase (UniProt:P07202) host organism:Homo sapiens

Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

ID: 1760688

Description: epitope description:EKTPVKKKARKSAGAA antigen name:Histone H1.4 host organism:Oryctolagus cuniculus

Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

ID: 1760689

Description: epitope description:EKTPVKKKARKSAGAA antigen name:Histone H1.4 host organism:Homo sapiens

Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

ID: 1760700

Description: epitope description:VSELITKAVAASKERS antigen name:Histone H1.4 host organism:Oryctolagus cuniculus

Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

ID: 1760702

Description: epitope description:VSELITKAVAASKERS antigen name:Histone H1.4 host organism:Homo sapiens

Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

ID: 1760705

Description: epitope description:RSGVSLAALKKALAAA antigen name:Histone H1.4 host organism:Oryctolagus cuniculus

Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

ID: 1760707

Description: epitope description:RSGVSLAALKKALAAA antigen name:Histone H1.4 host organism:Homo sapiens

Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

ID: 1760714

Description: epitope description:IKLGLKSLVSKGTLVQ antigen name:Histone H1.4 host organism:Homo sapiens

Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

ID: 1760722

Description: epitope description:LVQTKGTGASGSFKLN antigen name:Histone H1.4 host organism:Homo sapiens

Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

ID: 1760727

Description: epitope description:KLNKKAASGEAKPKAK antigen name:Histone H1.4 host organism:Homo sapiens

Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

ID: 1760729

Description: epitope description:AKKAGAAKAKKPAGAA antigen name:Histone H1.4 host organism:Homo sapiens

Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

ID: 1760731

Description: epitope description:AKKAGAAKAKKPAGAA antigen name:Histone H1.4 host organism:Homo sapiens

Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

ID: 1760732

Description: epitope description:AKKAGAAKAKKPAGAA antigen name:Histone H1.4 host organism:Homo sapiens

Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

ID: 1760766

Description: epitope description:KPKAAKPKKAAAKKK antigen name:Histone H1.4 host organism:Homo sapiens

Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

ID: 1760768

Description: epitope description:KSPKKAKAAKPKKAPK antigen name:Histone H1.4 host organism:Oryctolagus cuniculus

Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

ID: 1760772

Description: epitope description:KLNKKAASGEAKPKAK antigen name:Histone H1.4 host organism:Oryctolagus cuniculus

Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

ID: 1760783

Description: epitope description:TESLVLSPAPAKPKRVKASRRSASHPTYSEM antigen name:Histone H5 host organism:Oryctolagus cuniculus

Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

ID: 1760784

Description: epitope description:TESLVLSPAPAKPKRVKASRRSASHPTYSEM antigen name:Histone H5 host organism:Homo sapiens

Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

ID: 1760787

Description: epitope description:KSRKASKAKKVKRSK antigen name:Histone H5 host organism:Homo sapiens

Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

ID: 1760788

Description: epitope description:KSRKASKAKKVKRSK antigen name:Histone H5 host organism:Homo sapiens

Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

ID: 1760799

Description: epitope description:KEIKKVATPKKASKPKK antigen name:Histone H1.0 host organism:Homo sapiens

Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

ID: 1760800

Description: epitope description:KEIKKVATPKKASKPKK antigen name:Histone H1.0 host organism:Homo sapiens

Mapping of linear epitopes of human histone H1 recognized by rabbit anti-H1/H5 antisera and antibodies from autoimmune patients.

ID: 1760802

Description: epitope description:KEIKKVATPKKASKPKK antigen name:Histone H1.0 host organism:Homo sapiens

Increased receptor binding by bovine (b) TSH bound to monoclonal antibody to bTSHbeta-subunit.

ID: 1760812

Description: epitope description:LPK antigen name:Thyrotropin subunit beta host organism:Mus musculus antibody name:MoAb No.1

Increased receptor binding by bovine (b) TSH bound to monoclonal antibody to bTSHbeta-subunit.

ID: 1760820

Description: epitope description:PKYA antigen name:Thyrotropin subunit beta host organism:Mus musculus antibody name:MoAb No.3

Profile of the regions of acetylcholine receptor alpha chain recognized by T-lymphocytes and by antibodies in EAMG-susceptible and non-susceptible mou...

ID: 1760826

Description: epitope description:FAIVHMTKLLLDYTGK antigen name:Acetylcholine receptor subunit alpha host organism:Mus musculus SJL

Profile of the regions of acetylcholine receptor alpha chain recognized by T-lymphocytes and by antibodies in EAMG-susceptible and non-susceptible mou...

ID: 1760828

Description: epitope description:LGIWTYDGTKVSISPES antigen name:Acetylcholine receptor subunit alpha host organism:Mus musculus SJL

Profile of the regions of acetylcholine receptor alpha chain recognized by T-lymphocytes and by antibodies in EAMG-susceptible and non-susceptible mou...

ID: 1760830

Description: epitope description:SEHETRLVANLLENYN antigen name:Acetylcholine receptor subunit alpha host organism:Mus musculus SJL

Retro-inverso peptidomimetics as new immunological probes. Validation and application to the detection of antibodies in rheumatic diseases.

ID: 1760846

Description: epitope description:IRGERA antigen name:Histone H3.1 host organism:Mus musculus NZB X NZW

Identification of epitopes and affinity purification of thyroid stimulating auto-antibodies using synthetic human TSH receptor peptides.

ID: 1760851

Description: epitope description:IPSHAFSNLPNISRIYVSID antigen name:Thyrotropin receptor host organism:Homo sapiens

Identification of epitopes and affinity purification of thyroid stimulating auto-antibodies using synthetic human TSH receptor peptides.

ID: 1760855

Description: epitope description:LLKFLGIFNTGLKMFPDLTK antigen name:Thyrotropin receptor host organism:Homo sapiens

Identification of epitopes and affinity purification of thyroid stimulating auto-antibodies using synthetic human TSH receptor peptides.

ID: 1760856

Description: epitope description:PDLTKVYSTDIFFILEITDN antigen name:Thyrotropin receptor host organism:Homo sapiens

Identification of epitopes and affinity purification of thyroid stimulating auto-antibodies using synthetic human TSH receptor peptides.

ID: 1760858

Description: epitope description:FQGLCNETLTLKLYNNGFTS antigen name:Thyrotropin receptor host organism:Homo sapiens

Identification of epitopes and affinity purification of thyroid stimulating auto-antibodies using synthetic human TSH receptor peptides.

ID: 1760860

Description: epitope description:LDAVYLNKNKYLTVIDKDAF antigen name:Thyrotropin receptor host organism:Homo sapiens

Identification of epitopes and affinity purification of thyroid stimulating auto-antibodies using synthetic human TSH receptor peptides.

ID: 1760861

Description: epitope description:DKDAFGGVYSGPSLLDVSQT antigen name:Thyrotropin receptor host organism:Homo sapiens

Identification of epitopes and affinity purification of thyroid stimulating auto-antibodies using synthetic human TSH receptor peptides.

ID: 1760862

Description: epitope description:DVSQTSVTALPSKGLEHLKE antigen name:Thyrotropin receptor host organism:Homo sapiens

Identification of epitopes and affinity purification of thyroid stimulating auto-antibodies using synthetic human TSH receptor peptides.

ID: 1760865

Description: epitope description:LSYPSHCCAFKNQKKIRGIL antigen name:Thyrotropin receptor host organism:Homo sapiens

Identification of epitopes and affinity purification of thyroid stimulating auto-antibodies using synthetic human TSH receptor peptides.

ID: 1760871

Description: epitope description:GQELKNPQEETLQAFDSHYD antigen name:Thyrotropin receptor host organism:Homo sapiens

Identification of epitopes and affinity purification of thyroid stimulating auto-antibodies using synthetic human TSH receptor peptides.

ID: 1760873

Description: epitope description:VCTPKSDEFNPCEDIMGYK antigen name:Thyrotropin receptor host organism:Homo sapiens

Involvement of epitope mimicry in potentiation but not initiation of autoimmune disease.

ID: 1760938

Description: epitope description:SFYSSYIQTLTVAQ antigen name:E1B 55K host organism:Mus musculus SJL

Dual mechanism of perturbation of thyrotropin-mediated activation of thyroid cells by antibodies to the thyrotropin receptor (TSHR) and TSHR-derived p...

ID: 1760952

Description: epitope description:NALNSPLHQEYEENL antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

Dual mechanism of perturbation of thyrotropin-mediated activation of thyroid cells by antibodies to the thyrotropin receptor (TSHR) and TSHR-derived p...

ID: 1760953

Description: epitope description:NALNSPLHQEYEENL antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

Dual mechanism of perturbation of thyrotropin-mediated activation of thyroid cells by antibodies to the thyrotropin receptor (TSHR) and TSHR-derived p...

ID: 1760963

Description: epitope description:GYKEKSKFQDTHNNA antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

Dual mechanism of perturbation of thyrotropin-mediated activation of thyroid cells by antibodies to the thyrotropin receptor (TSHR) and TSHR-derived p...

ID: 1760964

Description: epitope description:YYVFFEEQEDEIIGF antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

Dual mechanism of perturbation of thyrotropin-mediated activation of thyroid cells by antibodies to the thyrotropin receptor (TSHR) and TSHR-derived p...

ID: 1760968

Description: epitope description:YYVFFEEQEDEIIGF antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

Dual mechanism of perturbation of thyrotropin-mediated activation of thyroid cells by antibodies to the thyrotropin receptor (TSHR) and TSHR-derived p...

ID: 1760969

Description: epitope description:EEQEDEIIGFGQELKN antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

Dual mechanism of perturbation of thyrotropin-mediated activation of thyroid cells by antibodies to the thyrotropin receptor (TSHR) and TSHR-derived p...

ID: 1760972

Description: epitope description:EEQEDEIIGFGQELKN antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

Dual mechanism of perturbation of thyrotropin-mediated activation of thyroid cells by antibodies to the thyrotropin receptor (TSHR) and TSHR-derived p...

ID: 1760976

Description: epitope description:PQEETLQAFDSHYDYT antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

Dual mechanism of perturbation of thyrotropin-mediated activation of thyroid cells by antibodies to the thyrotropin receptor (TSHR) and TSHR-derived p...

ID: 1760979

Description: epitope description:TLQAFDSHYDYTICGDSEDMV antigen name:Thyrotropin receptor host organism:Oryctolagus cuniculus New Zealand White

Increased prevalence of transfusion-transmitted virus and cross-reactivity with immunodominant epitopes of the HRES-1/p28 endogenous retroviral autoan...

ID: 1761118

Description: epitope description:TRYPTRAPSGPRPPS antigen name:Putative HTLV-1-related endogenous sequence host organism:Homo sapiens

Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

ID: 1763095

Description: epitope description:PAIALREY antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

ID: 1763102

Description: epitope description:YRKKMDIP antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

ID: 1762971

Description: epitope description:AAFYKTFK antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

ID: 1762978

Description: epitope description:KTVEPTGK antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

ID: 1762980

Description: epitope description:VEPTGKRF antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

ID: 1762981

Description: epitope description:EPTGKRFL antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

ID: 1762990

Description: epitope description:AVDVSASM antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

ID: 1762993

Description: epitope description:VSASMNQR antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

ID: 1762994

Description: epitope description:SASMNQRV antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

ID: 1762999

Description: epitope description:QRVLGSIL antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

ID: 1763011

Description: epitope description:VAAAMCMV antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

ID: 1763023

Description: epitope description:EKDSYVVA antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

ID: 1763026

Description: epitope description:SYVVAFSD antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

ID: 1763028

Description: epitope description:VVAFSDEM antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

ID: 1763037

Description: epitope description:PCPVTTDM antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

ID: 1763038

Description: epitope description:CPVTTDMT antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

ID: 1763047

Description: epitope description:QQVLMAMS antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

ID: 1763051

Description: epitope description:MAMSQIPA antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

ID: 1763058

Description: epitope description:AGGTDCSL antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

ID: 1763064

Description: epitope description:SLPMIWAQ antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

ID: 1763076

Description: epitope description:PADVFIVF antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

ID: 1763077

Description: epitope description:ADVFIVFT antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

ID: 1763085

Description: epitope description:DNETFAGG antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

ID: 1763090

Description: epitope description:AGGVHPAI antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

ID: 1763093

Description: epitope description:VHPAIALR antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

ID: 1763114

Description: epitope description:VCGMTSNG antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

Autoantibody to the leucine zipper region of 52 kDa Ro/SSA binds native 60 kDa Ro/SSA: identification of a tertiary epitope with components from 60 kD...

ID: 1763121

Description: epitope description:GFTIADPD antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens