Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

    ID: 1316107

    Description: epitope description:NDCSNSSIVY antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 1373489;

  2. Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

    ID: 1316111

    Description: epitope description:ADMIMHTPGC antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 1373489;

  3. Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

    ID: 1316118

    Description: epitope description:DNSSRCWVAL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 1373489;

  4. Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

    ID: 1316120

    Description: epitope description:RCWVALTPTL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 1373489;

  5. Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

    ID: 1316122

    Description: epitope description:ALTPTLAARN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 1373489;

  6. Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

    ID: 1316125

    Description: epitope description:TLAARNASVP antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 1373489;

  7. Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

    ID: 1316128

    Description: epitope description:VPTTTIRRHV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 1373489;

  8. Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

    ID: 1316140

    Description: epitope description:QVCGPVYCFT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 1373489;

  9. Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

    ID: 1316143

    Description: epitope description:CGSVFLVSQL antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 1373489;

  10. Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

    ID: 1316152

    Description: epitope description:NFSIYPGHLS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 1373489;

  11. Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

    ID: 1316157

    Description: epitope description:LSGHRMAWDM antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 1373489;

  12. Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

    ID: 1316164

    Description: epitope description:VVSQLLRIPQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 1373489;

  13. Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

    ID: 1318360

    Description: epitope description:RPCGIVPAKSVC antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 8603958;

  14. Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

    ID: 1318361

    Description: epitope description:PAKSVCGPVYCF antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 8603958;

  15. Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

    ID: 1318364

    Description: epitope description:VGTTDRSGAPTY antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 8603958;

  16. Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

    ID: 1318367

    Description: epitope description:NNTRPPLGNWFG antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 8603958;

  17. Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

    ID: 1318369

    Description: epitope description:CTWMNSTGFTKV antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 8603958;

  18. Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

    ID: 1318372

    Description: epitope description:PTDCFRKYPEAT antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 8603958;

  19. Immune response to epitopes of hepatitis C virus (HCV) structural proteins in HCV-infected humans and chimpanzees.

    ID: 1318390

    Description: epitope description:SIASWAIKWEYV antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 8603958;

  20. Use of overlapping synthetic peptides to characterize samples from blood donors with indeterminate results to hepatitis C virus core antigen.

    ID: 1318446

    Description: epitope description:KARRPEGRTWAQPGY antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9745151;

  21. Parvovirus B19 empty capsids as antigen carriers for presentation of antigenic determinants of dengue 2 virus.

    ID: 1318473

    Description: epitope description:ITVNPIVTEKDSPVNIE antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 16941345;

  22. Enhancing the immunogenicity and modulating the fine epitope recognition of antisera to a helical group A streptococcal peptide vaccine candidate from...

    ID: 1318475

    Description: epitope description:ASREAKKQVEKALE antigen name:UniProt:A2RGM0 host organism:Mus musculus B10.BR

    Publication: 11940119;

  23. Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

    ID: 1318658

    Description: epitope description:DVVTKLPLAVMG antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

    Publication: 8556499;

  24. Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

    ID: 1319223

    Description: epitope description:FLVNAWKSKKNP antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

    Publication: 8556499;

  25. Evidence of subtype-specific antibodies to antigenic epitopes in the NS5 region of hepatitis C virus in the circulation of patients with chronic hepat...

    ID: 1319247

    Description: epitope description:APEARQAIRSLT antigen name:Genome polyprotein host organism:Homo sapiens antibody name:HCV-positive sera

    Publication: 8556499;

  26. Epitope mapping of antibodies directed against hypervariable region 1 in acute self-limiting and chronic infections due to hepatitis C virus.

    ID: 1319323

    Description: epitope description:GPAATRTIGGSQAQTASGLVSMFSVGPSQK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9094694;

  27. Epitope mapping of antibodies directed against hypervariable region 1 in acute self-limiting and chronic infections due to hepatitis C virus.

    ID: 1319327

    Description: epitope description:GGPTRTIGGS antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 9094694;

  28. Epitope mapping of antibodies directed against hypervariable region 1 in acute self-limiting and chronic infections due to hepatitis C virus.

    ID: 1319330

    Description: epitope description:GPTRTIGGSQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9094694;

  29. Antigenicity and immunogenicity of novel chimeric hepatitis B surface antigen particles with exposed hepatitis C virus epitopes.

    ID: 1319331

    Description: epitope description:ETHVTGGSAGRTTAGLVGLLTPGAKQN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 11160717;

  30. Antigenicity and immunogenicity of novel chimeric hepatitis B surface antigen particles with exposed hepatitis C virus epitopes.

    ID: 1319332

    Description: epitope description:ETHVTGGSAGRTTAGLVGLLTPGAKQN antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 11160717;

  31. Epitope mapping of antibodies directed against hypervariable region 1 in acute self-limiting and chronic infections due to hepatitis C virus.

    ID: 1319339

    Description: epitope description:PTRTIGGSQA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9094694;

  32. Epitope mapping of antibodies directed against hypervariable region 1 in acute self-limiting and chronic infections due to hepatitis C virus.

    ID: 1319344

    Description: epitope description:RTIGGSQAQT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9094694;

  33. Epitope mapping of antibodies directed against hypervariable region 1 in acute self-limiting and chronic infections due to hepatitis C virus.

    ID: 1319353

    Description: epitope description:GGSQAQTASG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9094694;

  34. Epitope mapping of antibodies directed against hypervariable region 1 in acute self-limiting and chronic infections due to hepatitis C virus.

    ID: 1319357

    Description: epitope description:GSQAQTASGL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9094694;

  35. Epitope mapping of antibodies directed against hypervariable region 1 in acute self-limiting and chronic infections due to hepatitis C virus.

    ID: 1319359

    Description: epitope description:GSQAQTASGL antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 9094694;

  36. Epitope mapping of antibodies directed against hypervariable region 1 in acute self-limiting and chronic infections due to hepatitis C virus.

    ID: 1319365

    Description: epitope description:QAQTASGLVS antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 9094694;

  37. Epitope mapping of antibodies directed against hypervariable region 1 in acute self-limiting and chronic infections due to hepatitis C virus.

    ID: 1319374

    Description: epitope description:TASGLVSMFS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9094694;

  38. Epitope mapping of antibodies directed against hypervariable region 1 in acute self-limiting and chronic infections due to hepatitis C virus.

    ID: 1319379

    Description: epitope description:SGLVSMFSVG antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 9094694;

  39. Epitope mapping of antibodies directed against hypervariable region 1 in acute self-limiting and chronic infections due to hepatitis C virus.

    ID: 1319383

    Description: epitope description:GLVSMFSVGP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9094694;

  40. Characterization of mimotopes mimicking an immunodominant conformational epitope on the hepatitis C virus NS3 helicase.

    ID: 1319437

    Description: epitope description:WHRHWPSHPTQK host organism:Mus musculus BALB/c antibody name:3B1C4, 1, 2, 3,

    Publication: 14748062;

  41. Functional selection of vaccine candidate peptides from Staphylococcus aureus whole-genome expression libraries in vitro.

    ID: 1319454

    Description: epitope description:RAIVAIGCMFMITFVVLFYTNAT antigen name:Membrane protein, putative (UniProt:Q2G1E2) host organism:Homo sapiens

    Publication: 12874343;

  42. Acute-phase-specific heptapeptide epitope for diagnosis of parvovirus B19 infection.

    ID: 1319457

    Description: epitope description:MSKKSGKWWESDDKFAKAVY antigen name:Capsid protein VP1 host organism:Homo sapiens

    Publication: 10565913;

  43. Acute-phase-specific heptapeptide epitope for diagnosis of parvovirus B19 infection.

    ID: 1319517

    Description: epitope description:EFYEKVTGTDLELIQILKDH antigen name:Capsid protein VP1 host organism:Homo sapiens

    Publication: 10565913;

  44. Selection of continuous epitope sequences and their incorporation into poly(ethylene glycol)-peptide conjugates for use in serodiagnostic immunoassays...

    ID: 1319766

    Description: epitope description:GMTFRAQEGAFLTG antigen name:Basic membrane protein A host organism:Homo sapiens

    Publication: 11169923;

  45. Functional selection of vaccine candidate peptides from Staphylococcus aureus whole-genome expression libraries in vitro.

    ID: 1319775

    Description: epitope description:QSQDNSGDQRQVDLTPKK antigen name:Fibronectin-binding protein A host organism:Homo sapiens

    Publication: 12874343;

  46. Functional selection of vaccine candidate peptides from Staphylococcus aureus whole-genome expression libraries in vitro.

    ID: 1319779

    Description: epitope description:TQNISGTQVYQDPAIVQPK antigen name:Bifunctional autolysin host organism:Homo sapiens

    Publication: 12874343;

  47. Functional selection of vaccine candidate peptides from Staphylococcus aureus whole-genome expression libraries in vitro.

    ID: 1319834

    Description: epitope description:NHSQTPRYRRPKFPWFK antigen name:Other Staphylococcus aureus protein host organism:Homo sapiens

    Publication: 12874343;

  48. Interaction of immune sera with synthetic peptides corresponding to the structural protein region of hepatitis C virus.

    ID: 1319849

    Description: epitope description:VDMIAGAHWG antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 1373489;

  49. Potential role of molecular mimicry between Helicobacter pylori lipopolysaccharide and host Lewis blood group antigens in autoimmunity.

    ID: 1320098

    Description: epitope description:alpha-L-Fucp-(1->2)-beta-D-Galp-(1->3)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-D-Glcp antigen name:lipopolysaccharide host organi...

    Publication: 8675304;

  50. Potential role of molecular mimicry between Helicobacter pylori lipopolysaccharide and host Lewis blood group antigens in autoimmunity.

    ID: 1320139

    Description: epitope description:alpha-L-Fucp-(1->4)-[beta-D-Galp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-D-Glcp antigen name:Other Homo sapiens (human) p...

    Publication: 8675304;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston