Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Humanized monoclonal antibodies derived from chimpanzee Fabs protect against Japanese encephalitis virus in vitro and in vivo.

    ID: 1489892

    Description: epitope description:K179 antigen name:Genome polyprotein host organism:Pan troglodytes antibody name:A3

    Publication: 18480437;

  2. Humanized monoclonal antibodies derived from chimpanzee Fabs protect against Japanese encephalitis virus in vitro and in vivo.

    ID: 1489895

    Description: epitope description:I126 antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 18480437;

  3. Humanized monoclonal antibodies derived from chimpanzee Fabs protect against Japanese encephalitis virus in vitro and in vivo.

    ID: 1489896

    Description: epitope description:G302 antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 18480437;

  4. Humanized monoclonal antibodies derived from chimpanzee Fabs protect against Japanese encephalitis virus in vitro and in vivo.

    ID: 1489897

    Description: epitope description:K179 antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 18480437;

  5. Development of peptide mimotopes of lipooligosaccharide from nontypeable Haemophilus influenzae as vaccine candidates.

    ID: 1489912

    Description: epitope description:NMMRFTELSTPS host organism:Oryctolagus cuniculus New Zealand White

    Publication: 12682274;

  6. Humanized monoclonal antibodies derived from chimpanzee Fabs protect against Japanese encephalitis virus in vitro and in vivo.

    ID: 1489916

    Description: epitope description:K179 antigen name:Genome polyprotein host organism:Pan troglodytes antibody name:A3

    Publication: 18480437;

  7. Immunogold electron microscopic localization of the 2 EF-hand calcium-binding pollen allergen Phl p 7 and its homologues in pollens of grasses, weeds ...

    ID: 1491179

    Description: epitope description:ADEVQRMMAEIDTDGDGFIDFNEFISFCNANPGLMKDVAKVF antigen name:Phl p 7 host organism:Oryctolagus cuniculus antibody name:anti-P2

    Publication: 18204277;

  8. Development of peptide mimotopes of lipooligosaccharide from nontypeable Haemophilus influenzae as vaccine candidates.

    ID: 1491186

    Description: epitope description:NMMKYISPPIFL host organism:Oryctolagus cuniculus New Zealand White

    Publication: 12682274;

  9. Development of peptide mimotopes of lipooligosaccharide from nontypeable Haemophilus influenzae as vaccine candidates.

    ID: 1491193

    Description: epitope description:NMMKYISPPIFL host organism:Oryctolagus cuniculus New Zealand White

    Publication: 12682274;

  10. Antigenic variation of TprK V regions abrogates specific antibody binding in syphilis.

    ID: 1491214

    Description: epitope description:ASQASNVFQGVFLTNNMLQHDC antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus

    Publication: 16923793;

  11. Antigenic variation of TprK V regions abrogates specific antibody binding in syphilis.

    ID: 1491234

    Description: epitope description:YATARAGADILWDVGAKVSMKLWGL antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus

    Publication: 16923793;

  12. Antigenic variation of TprK V regions abrogates specific antibody binding in syphilis.

    ID: 1491237

    Description: epitope description:KKENAANVNGTVGADALLTLGYR antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus

    Publication: 16923793;

  13. Antigenic variation of TprK V regions abrogates specific antibody binding in syphilis.

    ID: 1491254

    Description: epitope description:QAAAAVPATKWKAEYCGYY antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus

    Publication: 16923793;

  14. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491263

    Description: epitope description:GFGSSTMGGKGG antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  15. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491268

    Description: epitope description:GGDLYTVTNSDD antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  16. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491275

    Description: epitope description:DPVNPAPGTLRY antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  17. Multi-epitope DNA vaccine linked to the A2/B subunit of cholera toxin protect mice against Toxoplasma gondii.

    ID: 1491292

    Description: epitope description:TCPDKKSTA antigen name:Major surface antigen host organism:Mus musculus BALB/c

    Publication: 18555564;

  18. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491297

    Description: epitope description:PMYIAGYKTFDG antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  19. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491299

    Description: epitope description:AGYKTFDGRGAQ antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;

  20. Determination of human linear IgE epitopes of Japanese cedar allergen Cry j 1.

    ID: 1491328

    Description: epitope description:NGGPCVFIKRVS antigen name:Cry j 1 host organism:Homo sapiens

    Publication: 16079500;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston