Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1312266

    Description: epitope description:STRITGGSMARDVYRFTGFFARGPSQN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  2. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1312268

    Description: epitope description:STRITGGSMARDVYRFTGFFARGPSQN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  3. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1312269

    Description: epitope description:STRITGGSMARDVYRFTGFFARGPSQN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  4. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1312278

    Description: epitope description:GTHTIGGSQAQQANRFVSMFSRGPSQK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  5. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1312291

    Description: epitope description:NTYASGGAVGHQTASFVRLLAPGPQQN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  6. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1312292

    Description: epitope description:ETHTTGGSAARATFGIANFFTPGAKQN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  7. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1312293

    Description: epitope description:ETHTTGGSAARATFGIANFFTPGAKQN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  8. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1312294

    Description: epitope description:ETHTTGGSAARATFGIANFFTPGAKQN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  9. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1312295

    Description: epitope description:ETHTTGGSAARATFGIANFFTPGAKQN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  10. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1312298

    Description: epitope description:ETHTTGGSAARATFGIANFFTPGAKQN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  11. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1312305

    Description: epitope description:NTRVTGGVQSRTTGTFVGLFTPGPSQR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  12. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1312310

    Description: epitope description:NTHVSGGRVGHTTRSLTSFFTPGPQQK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  13. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1312313

    Description: epitope description:NTHVSGGRVGHTTRSLTSFFTPGPQQK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  14. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1312314

    Description: epitope description:NTHVSGGRVGHTTRSLTSFFTPGPQQK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  15. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1312318

    Description: epitope description:NTHVSGGRVGHTTRSLTSFFTPGPQQK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  16. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1312327

    Description: epitope description:ETRVTGGAAGHTAFGFASFLAPGAKQK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  17. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1312335

    Description: epitope description:KTHVTGMVAGKNAHTLSSIFTSGPSQN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  18. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1312341

    Description: epitope description:GTHVTGGKVAYTTQGFTSFFSRGPSQK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  19. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1312366

    Description: epitope description:NTRVTGGVQSHTTRGFVGMFSLGPSQR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  20. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1312371

    Description: epitope description:NTRVTGGVQSHTTRGFVGMFSLGPSQR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 9649423;

  21. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1312380

    Description: epitope description:ETYIIGAATGRTTAGLTSLFSSGSQQN antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 9649423;

  22. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1312381

    Description: epitope description:ETHVTGGNAGRTTAGLVGLLTPGAKQN antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 9649423;

  23. Towards a solution for hepatitis C virus hypervariability: mimotopes of the hypervariable region 1 can induce antibodies cross-reacting with a large n...

    ID: 1312385

    Description: epitope description:ETHTTGGSAARATFGIANFFTPGAKQN antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 9649423;

  24. Cross-neutralization of human and palm civet severe acute respiratory syndrome coronaviruses by antibodies targeting the receptor-binding domain of sp...

    ID: 1312393

    Description: epitope description:D429, R441, E452, D454 antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:12B11, 18C2

    Publication: 16670317;

  25. Cross-neutralization of human and palm civet severe acute respiratory syndrome coronaviruses by antibodies targeting the receptor-binding domain of sp...

    ID: 1312394

    Description: epitope description:D429, R441, E452, D454 antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:12B11

    Publication: 16670317;

  26. Cross-neutralization of human and palm civet severe acute respiratory syndrome coronaviruses by antibodies targeting the receptor-binding domain of sp...

    ID: 1312395

    Description: epitope description:D429, R441, E452, D454 antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:12B11

    Publication: 16670317;

  27. Monoclonal antibodies to the hypervariable region 1 of hepatitis C virus capture virus and inhibit virus adsorption to susceptible cells in vitro.

    ID: 1312407

    Description: epitope description:HVTSTLTSLF antigen name:Genome polyprotein host organism:Mus musculus BDF1 antibody name:30F3

    Publication: 10753706;

  28. Monoclonal antibodies to the hypervariable region 1 of hepatitis C virus capture virus and inhibit virus adsorption to susceptible cells in vitro.

    ID: 1312413

    Description: epitope description:VTSTLTSLFRPGASQKIQL antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:30F4

    Publication: 10753706;

  29. Hepatitis C virus core region: helper T cell epitopes recognized by BALB/c and C57BL/6 mice.

    ID: 1312416

    Description: epitope description:RGPRLGVRATRKTSERPQPR antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 7537326;

  30. Hepatitis C virus core region: helper T cell epitopes recognized by BALB/c and C57BL/6 mice.

    ID: 1312417

    Description: epitope description:RPQPRGRRQPIPKARQPEGR antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 7537326;

  31. Hepatitis C virus core region: helper T cell epitopes recognized by BALB/c and C57BL/6 mice.

    ID: 1312418

    Description: epitope description:EGRAWAQPGYPWPLYGNEGL antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 7537326;

  32. Enhancing the immunogenicity and modulating the fine epitope recognition of antisera to a helical group A streptococcal peptide vaccine candidate from...

    ID: 1312421

    Description: epitope description:RVFPRGTVENPDKARELLNK antigen name:UniProt:A2RGM0 host organism:Mus musculus B10.BR antibody name:anti-p161

    Publication: 11940119;

  33. Monoclonal antibodies to the hypervariable region 1 of hepatitis C virus capture virus and inhibit virus adsorption to susceptible cells in vitro.

    ID: 1312435

    Description: epitope description:YTTGGAQSHTLR antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 X C3H antibody name:5A2

    Publication: 10753706;

  34. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1312519

    Description: epitope description:PHGGGWGQGGGTHNQWNKPSKPKTNLKHVA antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:anti-P4

    Publication: 16272297;

  35. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1312520

    Description: epitope description:PHGGGWGQGGGTHNQWNKPSKPKTNLKHVA antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:anti-PrP

    Publication: 16272297;

  36. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1312536

    Description: epitope description:WNKPSKPKTNLKHVAGAAAAGAVVGGLGGY antigen name:Major prion protein host organism:Mus musculus C57BL/6 antibody name:wt anti-P5

    Publication: 16272297;

  37. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1312543

    Description: epitope description:GAVVGGLGGYMLGSAMSRPMIHFGN antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:anti-P6

    Publication: 16272297;

  38. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1312544

    Description: epitope description:GAVVGGLGGYMLGSAMSRPMIHFGN antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:anti-P6

    Publication: 16272297;

  39. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1312546

    Description: epitope description:MLGSAMSRPMIHFGNDWEDRYYRENMYRYP antigen name:Major prion protein host organism:Mus musculus C57BL/6 antibody name:wt anti-P7

    Publication: 16272297;

  40. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1312555

    Description: epitope description:DWEDRYYRENMYRYPNQVYYRPVDQYSNQN antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:anti-P8

    Publication: 16272297;

  41. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1312563

    Description: epitope description:DWEDRYYRENMYRYPNQVYYRPVDQYSNQN antigen name:Major prion protein host organism:Mus musculus C57BL/6 antibody name:wt anti-P8

    Publication: 16272297;

  42. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1312564

    Description: epitope description:NQVYYRPVDQYSNQNNFVHDCVNITIKQHT antigen name:Major prion protein host organism:Mus musculus C57BL/6 antibody name:wt anti-P9

    Publication: 16272297;

  43. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1312568

    Description: epitope description:NQVYYRPVDQYSNQNNFVHDCVNITIKQHT antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:anti-PrP

    Publication: 16272297;

  44. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1312578

    Description: epitope description:NFVHDCVNITIKQHTVT antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:anti-PrP

    Publication: 16272297;

  45. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1312593

    Description: epitope description:MCVTQYQKESQAYYDGRRSSS antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:anti-P12

    Publication: 16272297;

  46. An anthrax lethal factor-neutralizing monoclonal antibody protects rats before and after challenge with anthrax toxin.

    ID: 1312626

    Description: epitope description:DSLSEEEKELLNRIQVDS + NAc(D1) antigen name:Lethal factor host organism:Mus musculus BALB/c antibody name:5B13B1

    Publication: 16177329;

  47. Crystal structure of a hydrophobic immunodominant antigenic site on hepatitis C virus core protein complexed to monoclonal antibody 19D9D6.

    ID: 1312630

    Description: epitope description:QIVGGVYLL antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:19D9D6

    Publication: 12574359;

  48. Cryptic epitopes in N-terminally truncated prion protein are exposed in the full-length molecule: dependence of conformation on pH.

    ID: 1312760

    Description: epitope description:TNMKHM antigen name:Mesocricetus auratus (Syrian golden hamster) protein host organism:Mus musculus antibody name:3F4

    Publication: 11391773;

  49. In vivo and in vitro evidence that cross-reactive antibodies to C-terminus of hypervariable region 1 do not neutralize heterologous hepatitis C virus.

    ID: 1312987

    Description: epitope description:ASQKIQLI antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:18Ie

    Publication: 12163260;

  50. In vivo and in vitro evidence that cross-reactive antibodies to C-terminus of hypervariable region 1 do not neutralize heterologous hepatitis C virus.

    ID: 1313005

    Description: epitope description:ASQKIQLI antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:2Aa

    Publication: 12163260;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston