Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. IgE binding capacity of synthetic and recombinant peptides of the major storage mite (Lepidoglyphus destructor) allergen, Lep d 2.

    ID: 1403287

    Description: epitope description:AANQDTAKVTIKVLA antigen name:Lep d 2 host organism:Oryctolagus cuniculus

    Publication: 9831803;

  2. Identification and expression of an allergen Asp f 13 from Aspergillus fumigatus and epitope mapping using human IgE antibodies and rabbit polyclonal ...

    ID: 1403324

    Description: epitope description:GLENLSGPAAVTARIKELATNGVVTNVKGSPNKLAYNGNA antigen name:Asp f 13 host organism:Homo sapiens antibody name:patient sera

    Publication: 10677362;

  3. IgE binding capacity of synthetic and recombinant peptides of the major storage mite (Lepidoglyphus destructor) allergen, Lep d 2.

    ID: 1403327

    Description: epitope description:GCKFIKCPVKKGEAL antigen name:Lep d 2 host organism:Oryctolagus cuniculus

    Publication: 9831803;

  4. IgE binding capacity of synthetic and recombinant peptides of the major storage mite (Lepidoglyphus destructor) allergen, Lep d 2.

    ID: 1403335

    Description: epitope description:GTIPAITPKVKADVT antigen name:Lep d 2 host organism:Oryctolagus cuniculus

    Publication: 9831803;

  5. IgE binding capacity of synthetic and recombinant peptides of the major storage mite (Lepidoglyphus destructor) allergen, Lep d 2.

    ID: 1403339

    Description: epitope description:KADVTAELIGDHGVM antigen name:Lep d 2 host organism:Oryctolagus cuniculus

    Publication: 9831803;

  6. Identification and expression of an allergen Asp f 13 from Aspergillus fumigatus and epitope mapping using human IgE antibodies and rabbit polyclonal ...

    ID: 1403342

    Description: epitope description:ASNTSPASAPNALTVAAINKSNARASFSNYGSVVD antigen name:Asp f 13 host organism:Homo sapiens antibody name:patient sera

    Publication: 10677362;

  7. Identification and expression of an allergen Asp f 13 from Aspergillus fumigatus and epitope mapping using human IgE antibodies and rabbit polyclonal ...

    ID: 1403345

    Description: epitope description:ALTTQKGAPWGLGSISHKGQASTDYIYD antigen name:Asp f 13 host organism:Homo sapiens antibody name:patient sera

    Publication: 10677362;

  8. IgE binding capacity of synthetic and recombinant peptides of the major storage mite (Lepidoglyphus destructor) allergen, Lep d 2.

    ID: 1403357

    Description: epitope description:GEVTELDISGCSGDT antigen name:Lep d 2 host organism:Oryctolagus cuniculus

    Publication: 9831803;

  9. Different crystal packing in Fab-protein L semi-disordered peptide complex.

    ID: 1403365

    Description: epitope description:STNPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLG antigen name:Genome polyprotein host organism:Mus musculus antibody name:19D9D6

    Publication: 15930632;

  10. Analyses of the antigenicity of influenza haemagglutinin at the pH optimum for virus-mediated membrane fusion.

    ID: 1403372

    Description: epitope description:D63 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:HC45

    Publication: 6192202;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston